BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00918 (732 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 1.0 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 26 1.4 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 23 7.4 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 26.2 bits (55), Expect = 1.0 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 110 RFRHLSIILRCMMATHHSPNEKLTICCENLQ 18 RFR S +L+ M +SPN +LT C + L+ Sbjct: 1992 RFRDRSYLLQAMTHASYSPN-RLTDCYQRLE 2021 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 25.8 bits (54), Expect = 1.4 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 608 IHVCVFRK*QIEY-ILFLLFRVTFLRQIINVLDKCS 712 IHVC+ RK +EY LFLL+ T + + + KC+ Sbjct: 221 IHVCMARKAWLEYEELFLLYSATL--KDLKLAKKCT 254 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +1 Query: 64 WVAIIQRKIIDRCLNLAYDIFKIKRIYYTSSEQQHSDR 177 W + + K I CL + + + I+Y + Q+S+R Sbjct: 149 WCTVRRAKTIIACLTMVGSVHSVPYIFYAGT--QYSER 184 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 766,858 Number of Sequences: 2352 Number of extensions: 15122 Number of successful extensions: 24 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -