BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00918 (732 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT025862-1|ABF85764.2| 360|Drosophila melanogaster RT01015p pro... 29 8.6 BT023900-1|ABA81834.1| 1576|Drosophila melanogaster LP13775p pro... 29 8.6 AJ556820-1|CAD89219.3| 1641|Drosophila melanogaster Tho2 protein... 29 8.6 AF465773-1|AAL74189.1| 66|Drosophila melanogaster fork head do... 29 8.6 AE014298-562|AAF45896.3| 360|Drosophila melanogaster CG12632-PB... 29 8.6 AE014134-342|AAF51302.2| 1641|Drosophila melanogaster CG31671-PA... 29 8.6 AE013599-1871|AAF58260.1| 856|Drosophila melanogaster CG13942-P... 29 8.6 >BT025862-1|ABF85764.2| 360|Drosophila melanogaster RT01015p protein. Length = 360 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 350 DLFSVNYSREKYWKNKARHQLLLRPH 427 D F S + WKN RH L + PH Sbjct: 47 DRFPYYKSNDDRWKNSVRHNLSINPH 72 >BT023900-1|ABA81834.1| 1576|Drosophila melanogaster LP13775p protein. Length = 1576 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +2 Query: 296 YIPQLT*HRLSI*LLKKIDLFSVNYSREKYWKNKARHQLLLRPHPESF 439 Y+ HRLS LK + +V E+ + + Q LLRPH +S+ Sbjct: 563 YLEPTKTHRLSNPALKALQKNAVQSYVERQQQQQKEEQQLLRPHSQSY 610 >AJ556820-1|CAD89219.3| 1641|Drosophila melanogaster Tho2 protein protein. Length = 1641 Score = 28.7 bits (61), Expect = 8.6 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 3/24 (12%) Frame = +3 Query: 198 PARWKIF-PL--SYIPTGAIVLQI 260 P RW +F PL SY+PTGAI+ ++ Sbjct: 281 PDRWNLFIPLLRSYMPTGAIICEV 304 >AF465773-1|AAL74189.1| 66|Drosophila melanogaster fork head domain 3F protein. Length = 66 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 350 DLFSVNYSREKYWKNKARHQLLLRPH 427 D F S + WKN RH L + PH Sbjct: 33 DRFPYYKSNDDRWKNSVRHNLSINPH 58 >AE014298-562|AAF45896.3| 360|Drosophila melanogaster CG12632-PB protein. Length = 360 Score = 28.7 bits (61), Expect = 8.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 350 DLFSVNYSREKYWKNKARHQLLLRPH 427 D F S + WKN RH L + PH Sbjct: 47 DRFPYYKSNDDRWKNSVRHNLSINPH 72 >AE014134-342|AAF51302.2| 1641|Drosophila melanogaster CG31671-PA protein. Length = 1641 Score = 28.7 bits (61), Expect = 8.6 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 3/24 (12%) Frame = +3 Query: 198 PARWKIF-PL--SYIPTGAIVLQI 260 P RW +F PL SY+PTGAI+ ++ Sbjct: 281 PDRWNLFIPLLRSYMPTGAIICEV 304 >AE013599-1871|AAF58260.1| 856|Drosophila melanogaster CG13942-PA protein. Length = 856 Score = 28.7 bits (61), Expect = 8.6 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +2 Query: 296 YIPQLT*HRLSI*LLKKIDLFSVNYSREKYWKNKARHQLLLRPHPESF 439 Y+ HRLS LK + +V E+ + + Q LLRPH +S+ Sbjct: 501 YLEPTKTHRLSNPALKALQKNAVQSYVERQQQQQKEEQQLLRPHSQSY 548 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,372,509 Number of Sequences: 53049 Number of extensions: 650217 Number of successful extensions: 1486 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1486 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3293648160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -