BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00915 (726 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 65 6e-11 SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) 29 5.1 SB_38432| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_6761| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_48238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_9112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 64.9 bits (151), Expect = 6e-11 Identities = 29/49 (59%), Positives = 33/49 (67%) Frame = +1 Query: 580 KMTHMVGSYPPKIEIQSYTTPPEDAPSGMMARGSYSVNSLFTDDDKNVH 726 K + MVGSY PK E Y TP ++AP GMMARG Y + S F DDDKN H Sbjct: 277 KDSFMVGSYGPKFEPHEYLTPIDEAPKGMMARGKYIIRSKFIDDDKNSH 325 Score = 34.7 bits (76), Expect = 0.077 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +2 Query: 257 EEILAADQEDESLRKYKEALLGQAQAGAVIVEPDDPRKVIVKKLAL 394 EEI D +DE+L KYK+ LLG P P+ V+V+K+A+ Sbjct: 31 EEIQNLDADDEALVKYKQTLLGVTPEEL----PKGPKNVVVEKVAI 72 >SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) Length = 2436 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 239 TSREDLEEILAADQEDESLRKYKEALLGQAQAGA-VIVEPDDPRKVIVKKLALCVV 403 T+ + ++ +D ED++ YKE G+ +GA EPDD + ++++ + Sbjct: 776 TAASRIRQLAMSDSEDDASSSYKEKPAGRRSSGASQNSEPDDDILTLSQRISQAAI 831 >SB_38432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 601 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 592 MVGSYPPKIEIQSYTTPPEDAPSGMMARGSYSVNSLF 702 ++ SY I TPPE A SGM + G Y+ + + Sbjct: 543 VINSYGQYITTAREQTPPEMAASGMASSGQYTSSGTY 579 >SB_6761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 28.3 bits (60), Expect = 6.7 Identities = 17/64 (26%), Positives = 28/64 (43%) Frame = +1 Query: 22 RHFFGLKNLETANRCKFYNYLVFKCFFLFRLLVLCKKSFVTCYKKRICLENLK*PIHPKR 201 + FF K + T N N + FFL LC + + + ICL ++ I P R Sbjct: 52 QEFFIDKKMATQNEYASQNKRTERTFFLITKAALCLEYILGRFVVLICLSSVVSAIQPFR 111 Query: 202 IQRK 213 + ++ Sbjct: 112 LHKE 115 >SB_48238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 305 KEALLGQAQAGAVIVEPDDPRKVIVKKLALCVVGR 409 +E LL + G IVEP DP +I + +A C++ R Sbjct: 8 REVLL-EGVEGVRIVEPCDPSGLIAENVAHCILSR 41 >SB_9112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 305 KEALLGQAQAGAVIVEPDDPRKVIVKKLALCVVGR 409 +E LL + G IVEP DP +I + +A C++ R Sbjct: 32 REVLL-EGVEGVRIVEPCDPSGLIAENVAHCILSR 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,920,912 Number of Sequences: 59808 Number of extensions: 407460 Number of successful extensions: 789 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -