BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00914 (719 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC839.03c |||neddylation protein Dcn1|Schizosaccharomyces pomb... 34 0.023 SPCC1223.11 |ptc2||protein phosphatase 2C Ptc2 |Schizosaccharomy... 26 6.2 >SPBC839.03c |||neddylation protein Dcn1|Schizosaccharomyces pombe|chr 2|||Manual Length = 251 Score = 33.9 bits (74), Expect = 0.023 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +3 Query: 258 ASYDADGAWPVMLDEFVEWLR 320 ++YD +GAWP ++DEFV + R Sbjct: 222 SNYDFEGAWPTLIDEFVSYYR 242 Score = 31.9 bits (69), Expect = 0.095 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +2 Query: 23 NDPHIFKAIYRYSYDFARDKEQRSLDTEVAGALLGVLL 136 +D + KAIY Y+Y A DK +++L T +A +LL Sbjct: 139 SDASLQKAIYIYTYPLACDKGKKTLSTSIAIEFFQILL 176 >SPCC1223.11 |ptc2||protein phosphatase 2C Ptc2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 370 Score = 25.8 bits (54), Expect = 6.2 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +2 Query: 320 GERLINAPGQLRLRGPSTLTSSAHLYLQVLMPSQTAEFIYKRGKLYDTRS 469 GE P LRGP+T+ + +L L+ A Y G YD+ S Sbjct: 311 GEGPCAPPSYAELRGPNTIADARNLQLEY---DHIASHEYGSGDTYDSDS 357 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,324,818 Number of Sequences: 5004 Number of extensions: 40610 Number of successful extensions: 110 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -