BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00914 (719 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0801 + 21349434-21349438,21349952-21349978,21351175-213512... 43 3e-04 06_01_0903 - 6939672-6939782,6940051-6940110,6940221-6940322,694... 39 0.003 07_03_1373 - 26110436-26110584,26110585-26110752,26110829-261108... 33 0.23 08_01_0685 + 6025975-6026074,6026168-6026357,6026963-6027034,602... 30 1.6 >08_02_0801 + 21349434-21349438,21349952-21349978,21351175-21351249, 21351333-21351369,21351469-21351552,21351821-21351881, 21351961-21352067,21352162-21352227,21352366-21352461 Length = 185 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +3 Query: 255 LASYDADGAWPVMLDEFVEWLRANDS 332 L +YD+D AWP++LD FVEWLR N S Sbjct: 160 LDNYDSDLAWPLILDNFVEWLRENKS 185 >06_01_0903 - 6939672-6939782,6940051-6940110,6940221-6940322, 6940464-6940513,6940686-6940750,6940849-6940931, 6941117-6941140,6941798-6941856,6942041-6942174, 6942823-6942884,6942908-6942976 Length = 272 Score = 39.1 bits (87), Expect = 0.003 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = +3 Query: 255 LASYDADGAWPVMLDEFVEWLRAN 326 L++YD +GAWP ++DEFVE+L N Sbjct: 242 LSNYDEEGAWPYLIDEFVEYLTEN 265 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +2 Query: 8 LRNLLNDPHIFKAIYRYSYDFARDKEQRSLDTEVAGALLGVLLP--RWALRAALCEFI 175 LR + D H F+ IY +++ +AR+K Q+SL E A + +L W L C+F+ Sbjct: 158 LRAEIKDDHKFREIYNFAFAWAREKGQKSLALETALGMWQLLFAERHWPLIDHWCQFL 215 >07_03_1373 - 26110436-26110584,26110585-26110752,26110829-26110896, 26111755-26111800,26111929-26112025,26112802-26112884, 26112987-26113062,26113147-26113195,26113517-26113601, 26114247-26114331 Length = 301 Score = 33.1 bits (72), Expect = 0.23 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 255 LASYDADGAWPVMLDEFVE 311 L YD GAWPV++D+FVE Sbjct: 152 LEGYDPKGAWPVLVDDFVE 170 >08_01_0685 + 6025975-6026074,6026168-6026357,6026963-6027034, 6027187-6027258,6027354-6027425,6027784-6027855, 6027980-6028051,6028134-6028205,6028483-6028554, 6028791-6028865,6028970-6029041,6029134-6029199, 6029267-6029332,6029409-6029453,6029542-6029606, 6029697-6030076,6030455-6030653,6030725-6030883, 6030966-6031084,6031156-6031200,6031226-6031791, 6031871-6032021,6032117-6032454,6033702-6033765, 6034329-6034370,6035572-6035575,6035853-6036039, 6037252-6037323,6037687-6037758,6037867-6037938, 6038019-6038090,6038651-6038725,6038815-6038886, 6038988-6039053,6039163-6039228,6039348-6039392, 6039469-6039533,6039615-6039994,6040070-6040202, 6040354-6040512,6040599-6040717,6040805-6041015, 6041155-6041386,6041469-6041619,6041725-6042084 Length = 1952 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +2 Query: 14 NLLNDPHIFKAIYRYSYDFARDKEQRSLDTEVAGALLGVLLPRWALRAALCE 169 N+L DP + I + D+++ ++T+VAG G L P +A+R L E Sbjct: 1748 NILLDPDLTPKISDFGLAKLYDEKKTHVNTKVAGT-FGYLAPEYAMRGHLTE 1798 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,936,176 Number of Sequences: 37544 Number of extensions: 266630 Number of successful extensions: 703 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -