Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00909
         (718 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcript...    23   7.2  

>AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcriptase
            protein.
          Length = 973

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 1/55 (1%)
 Frame = +2

Query: 212  NFYITGVDRNHDC*RWYLSVQKRYSYRYRNA-VSVHSLTYY*LVPCALFCGCRRE 373
            NFY+T    +H C R YL   +  S     A VS+   T + L  C  F   R E
Sbjct: 880  NFYMTQFLSDHGCFRSYLHKYRHASSPDCPACVSIVESTEHVLFHCPRFAEERHE 934


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 666,514
Number of Sequences: 2352
Number of extensions: 12760
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 72765525
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)