BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00908 (659 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 24 1.1 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 24 1.1 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 3.4 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 3.4 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 22 4.5 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 22 4.5 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 6.0 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 6.0 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 6.0 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 6.0 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 6.0 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 6.0 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 6.0 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 6.0 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 6.0 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 6.0 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 6.0 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 6.0 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 6.0 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 6.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 6.0 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 6.0 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 6.0 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 6.0 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 7.9 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 7.9 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 7.9 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 7.9 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 7.9 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 7.9 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 7.9 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 7.9 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 7.9 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 7.9 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 7.9 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 7.9 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 7.9 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 7.9 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 7.9 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 7.9 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 7.9 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 7.9 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 7.9 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 7.9 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 7.9 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRER 109 R+R S SR E + YK + K+ RER Sbjct: 36 RKRYSRSREREQKSYKNERKYRKYRER 62 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRER 109 R+R S SR E + YK + K+ RER Sbjct: 36 RKRYSRSREREQKSYKNERKYRKYRER 62 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 326 DKSDLLFGVEQGVDMIFASFIRNGAALHEIRGIL 427 D D L+GV+ GVD I + N +H+ R I+ Sbjct: 118 DACDRLWGVDTGVDDI----LGNNTVIHQPRIII 147 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E R YK ++ + RE Sbjct: 269 RKRYSRSREREQRSYKNENSYRKYRE 294 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRER 109 R+R S SR E YK + ++ RER Sbjct: 36 RKRYSRSREREQNSYKNEKEYRKYRER 62 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRER 109 R+R S SR E YK + ++ RER Sbjct: 36 RKRYSRSREREQNSYKNEKEYRKYRER 62 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 36 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 80 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 36 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 80 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 36 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 80 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 36 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 80 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 36 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 80 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 36 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 80 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 36 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 80 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 285 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 329 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 285 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 329 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 285 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 329 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 285 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 329 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 285 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 329 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 47 SRTEEGRDYKVDDKFGLSRER 109 SR E+G Y+ D + SR+R Sbjct: 237 SRHEDGNSYRNDGERSCSRDR 257 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 285 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 329 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRER 109 R+R S SR E YK + ++ RER Sbjct: 269 RKRYSRSREREQNSYKNEREYRKYRER 295 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 6.0 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 R+R S SR E + YK ++ + RE R +E RE R Sbjct: 269 RKRYSRSREREQKSYKNENSYRKYRETSK-ERSRDRRERGRSREHR 313 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.8 bits (44), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRERQC*YNLRGLQEHNECREAR 166 RRR S SR E + YK + ++ RE R +E RE R Sbjct: 285 RRRYSRSREREQKSYKNEREYREYRETSR-ERSRDRRERGRSREHR 329 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 6.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 206 DDRDEAIIDEDSVSWLHDIRYVLVVHVNCI 117 DD +AIID D S +I L V CI Sbjct: 71 DDLIKAIIDSDRHSTTREIAEKLHVSHTCI 100 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 270 GKASTCPAYPWTY 308 G AS C A+PW + Sbjct: 287 GVASFCKAFPWHF 299 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 36 RKRYSRSREREKKSYKNENSYRKYRE 61 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 36 RKRYSRSREREKKSYKNENSYRKYRE 61 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 36 RKRYSRSREREKKSYKNENSYRKYRE 61 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 36 RKRYSRSREREKKSYKNENSYRKYRE 61 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 36 RKRYSRSREREQKSYKNENSYRKYRE 61 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 36 RKRYSRSREREQKSYKNENSYRKYRE 61 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 36 RKRYSRSREREQKSYKNENSYRKYRE 61 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 36 RKRYSRSREREQKSYKNENSYRKYRE 61 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 36 RKRYSRSREREQKSYKNENSYRKYRE 61 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 36 RKRYSRSREREQKSYKNENSYRKYRE 61 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 269 RKRYSRSREREQKSYKNENSYRKYRE 294 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 258 RKRYSRSREREQKSYKNENSYRKYRE 283 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 RRR S SR E + YK + ++ RE Sbjct: 284 RRRYSRSREREQKSYKNEREYREYRE 309 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 269 RKRYSRSREREQKSYKNENSYRKYRE 294 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 269 RKRYSRSREREQKSYKNENSYRKYRE 294 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 258 RKRYSRSREREQKSYKNENSYRKYRE 283 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 269 RKRYSRSREREQKSYKNENSYRKYRE 294 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 274 RKRYSRSREREQKSYKNENSYRKYRE 299 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 269 RKRYSCSREREQKSYKNENSYRKYRE 294 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 29 RRRLS*SRTEEGRDYKVDDKFGLSRE 106 R+R S SR E + YK ++ + RE Sbjct: 269 RKRYSRSREREKKSYKNENSYRKYRE 294 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -2 Query: 343 EQVRLVLLGDC 311 EQ+R+ +LGDC Sbjct: 313 EQLRIKILGDC 323 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,198 Number of Sequences: 438 Number of extensions: 4206 Number of successful extensions: 53 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -