BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00906 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 2.0 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 2.0 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 23 2.0 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +3 Query: 222 KWQCKFQTTFIFFNYFQHYIVQMYLK*CRQVTLS 323 ++ C + +F F +Y++Q+Y+ C V +S Sbjct: 227 EYSC-LKVDLLFKREFSYYLIQIYIPCCMLVIVS 259 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +3 Query: 222 KWQCKFQTTFIFFNYFQHYIVQMYLK*CRQVTLS 323 ++ C + +F F +Y++Q+Y+ C V +S Sbjct: 227 EYSC-LKVDLLFKREFSYYLIQIYIPCCMLVIVS 259 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 339 IQCYPYLVNIFYILCTGLVHNYR 407 IQ PY +NIF + L+ YR Sbjct: 156 IQACPYTLNIFDLTSDKLLRQYR 178 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,108 Number of Sequences: 438 Number of extensions: 3026 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -