BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00905 (738 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032647-1|CAA21688.2| 470|Caenorhabditis elegans Hypothetical ... 29 2.6 U40958-5|AAA81764.1| 654|Caenorhabditis elegans Hypothetical pr... 29 3.4 U28737-8|ABA61869.1| 537|Caenorhabditis elegans Hypothetical pr... 28 6.0 U28737-7|ABA61870.1| 501|Caenorhabditis elegans Hypothetical pr... 28 6.0 Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical p... 28 7.9 >AL032647-1|CAA21688.2| 470|Caenorhabditis elegans Hypothetical protein Y57A10B.1 protein. Length = 470 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 325 QGFRREPAEGSLTCVVLCVICKYFIYLFIYIYACIHS 435 + +RRE AE L+ V L +F+ F+ +YA + S Sbjct: 370 ESYRREEAENVLSTVTLIAAMVFFLSFFLAMYAHVKS 406 >U40958-5|AAA81764.1| 654|Caenorhabditis elegans Hypothetical protein F09F9.4 protein. Length = 654 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/52 (26%), Positives = 28/52 (53%) Frame = +2 Query: 470 HALARVCRDDIESTADIIYLILLRTARARQHTHKTIRALQNTITDTEITVLF 625 H L ++CR+D+ S + Y + + KT+ A+ T+ DT+ +++F Sbjct: 117 HILPKLCREDL-SDIQLEYRSFQVFPGEEESSWKTVSAVAKTLKDTKTSLIF 167 >U28737-8|ABA61869.1| 537|Caenorhabditis elegans Hypothetical protein F14B8.5a protein. Length = 537 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 619 HCNFGVSNGIL*CAYSFMRVLPCACSTQQY 530 +CNF SN C +SF+ V+ CA + QY Sbjct: 172 NCNFVPSNHQNQCQFSFVLVISCADQSIQY 201 >U28737-7|ABA61870.1| 501|Caenorhabditis elegans Hypothetical protein F14B8.5b protein. Length = 501 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 619 HCNFGVSNGIL*CAYSFMRVLPCACSTQQY 530 +CNF SN C +SF+ V+ CA + QY Sbjct: 136 NCNFVPSNHQNQCQFSFVLVISCADQSIQY 165 >Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical protein Y69H2.14 protein. Length = 338 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 6/38 (15%) Frame = -1 Query: 123 DNCKPQSPARRSFSGLPGPLGQ----GE--HADSFSVA 28 ++C+ +PAR+ G PGP GQ GE H+D+ S A Sbjct: 190 NDCQTCAPARQGAPGPPGPAGQPGQPGEPGHSDTSSTA 227 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,670,990 Number of Sequences: 27780 Number of extensions: 295773 Number of successful extensions: 852 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 850 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1735436670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -