BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00904 (671 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000499FC0 Cluster: zinc finger protein; n=1; Entamo... 36 0.89 UniRef50_Q9EN15 Cluster: AMV033; n=1; Amsacta moorei entomopoxvi... 36 0.89 UniRef50_Q17N89 Cluster: Putative uncharacterized protein; n=1; ... 35 1.6 >UniRef50_UPI0000499FC0 Cluster: zinc finger protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: zinc finger protein - Entamoeba histolytica HM-1:IMSS Length = 198 Score = 35.9 bits (79), Expect = 0.89 Identities = 20/68 (29%), Positives = 35/68 (51%) Frame = -1 Query: 608 ITVFFSFEKLTLRCRAIWALNWVTTNVLVILQT*Q*LSPLIYSMSEWLISSLKQKQTLSE 429 I + F F+KL + CR I +L ++ N+ ++ + Q L ++Y + S +K S Sbjct: 118 IFLLFQFKKLHIECRLI-SLGFLFGNISILFEFYQNLKTIVYQLQFNFTCSEYKKYLNSR 176 Query: 428 FSHYQHHY 405 H Q+HY Sbjct: 177 RMHCQYHY 184 >UniRef50_Q9EN15 Cluster: AMV033; n=1; Amsacta moorei entomopoxvirus 'L'|Rep: AMV033 - Amsacta moorei entomopoxvirus (AmEPV) Length = 429 Score = 35.9 bits (79), Expect = 0.89 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = -3 Query: 645 NIIKWNISTYN*N---YCFFFVRETHFEMSRHMGTELGNYKCFSHSADVAMIITVD 487 NIIK+NISTY + YC+F + ++ H+ +E+ NY F+ + ++ D Sbjct: 178 NIIKYNISTYYDSIMFYCYFDIDINCNKIEHHISSEINNYTTFTKFVFLKILFVPD 233 >UniRef50_Q17N89 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 508 Score = 35.1 bits (77), Expect = 1.6 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +1 Query: 457 LLMSHSLIE*INGDNHCYVCRMTKTFVVTQFSAHMARH 570 LL+SH ++ + GD HC C +T +F+AH+A+H Sbjct: 195 LLLSHLMLTHVEGDYHCEECDITFR-ASPEFNAHLAKH 231 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 634,863,809 Number of Sequences: 1657284 Number of extensions: 11816467 Number of successful extensions: 24613 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24608 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51652897375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -