BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00902 (731 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 25 0.63 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 25 0.83 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 23 2.5 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 5.9 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 7.8 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 25.0 bits (52), Expect = 0.63 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -2 Query: 640 PSGFPAASPKLWYLLVFQ*TRWSSPENERPSTVCSEPSPLSAP 512 PS AA W + +SPE + V EP+PL++P Sbjct: 56 PSTSAAADVDGWQVTPLPSDGTTSPEPDPEIPVAPEPAPLASP 98 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 24.6 bits (51), Expect = 0.83 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 599 QVPQLRGGGRKTRWTSRFR 655 QVPQL GGGR+ +R R Sbjct: 320 QVPQLAGGGRRGPGPARSR 338 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 23.0 bits (47), Expect = 2.5 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = -2 Query: 697 LSSSRCFEPTINRTPKTASPSGFPAASP---KLWYLLVFQ*TRWSSPENE 557 L + C E + + TP +S S F AAS +++ F+ SPE+E Sbjct: 191 LPTPTCSEASSSPTPSHSSESSFSAASSYTNTIYHQENFENYEPKSPEDE 240 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/32 (21%), Positives = 15/32 (46%) Frame = +1 Query: 385 NHPRSIVNPGYCWRVDENGYDSELKGGPLNND 480 +HP ++++ GY + YD G + + Sbjct: 125 SHPYTVISNGYSSPMSSGSYDPYSPNGKIGRE 156 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 565 ENERPSTVCSEPSPLSAPQG 506 E ERPS +P SAP G Sbjct: 45 EEERPSFKSRKPKNYSAPIG 64 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,627 Number of Sequences: 336 Number of extensions: 4096 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -