BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00902 (731 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr... 26 4.8 SPCC1322.04 |||UTP-glucose-1-phosphate uridylyltransferase |Schi... 26 4.8 SPAC25G10.08 |||translation initiation factor eIF3b |Schizosacch... 26 6.4 SPBC2A9.04c |||sir antagonist ortholog |Schizosaccharomyces pomb... 25 8.4 >SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr 2|||Manual Length = 1471 Score = 26.2 bits (55), Expect = 4.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 727 CCTKGSNCTTLSSSRCFEPTINRTPKTASPSG 632 CCT+GS L +S+C I+ + +P+G Sbjct: 1238 CCTEGS-INALLNSKCLPEFIDAADENTTPTG 1268 >SPCC1322.04 |||UTP-glucose-1-phosphate uridylyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 506 Score = 26.2 bits (55), Expect = 4.8 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -2 Query: 304 ECHVLEETSLSMSPDRFTGISPFVVCHYHFTDVTDDDSSI 185 + + + + M+P RF G +P V HF V D + I Sbjct: 405 DLYSINHGQVEMNPRRFGGTAPLVKLGAHFKKVADFSAHI 444 >SPAC25G10.08 |||translation initiation factor eIF3b |Schizosaccharomyces pombe|chr 1|||Manual Length = 725 Score = 25.8 bits (54), Expect = 6.4 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 444 IAVFVDTPTVARIDDGTRMIDRVPPFQW 361 I+V+ +TP++A +D T ID V F+W Sbjct: 331 ISVY-ETPSLALVDKKTIKIDGVQNFEW 357 >SPBC2A9.04c |||sir antagonist ortholog |Schizosaccharomyces pombe|chr 2|||Manual Length = 741 Score = 25.4 bits (53), Expect = 8.4 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 562 SPENSTWFTGTQASTTASGRRQE 630 SPE+++W G+Q + A+ R E Sbjct: 367 SPESTSWLPGSQTNIPANTNRSE 389 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,021,868 Number of Sequences: 5004 Number of extensions: 66876 Number of successful extensions: 187 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 187 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -