BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00897 (654 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 27 0.18 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 25 0.72 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.9 AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 22 5.1 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 26.6 bits (56), Expect = 0.18 Identities = 20/85 (23%), Positives = 36/85 (42%) Frame = +3 Query: 24 PKLKTQQSNNKRIREPNEEDLKQSNKKTKLISCTGTFETAVNDKSMSNQNDAQESEPINY 203 P LK++ KR ++E+ K +FE + + M+N + Q ++ +N Sbjct: 55 PVLKSRSFGRKRKSISSDEENSFQGKHKSRRKAPQSFEDIQHQRVMANVRERQRTQSLN- 113 Query: 204 DVIMDQVFANIDADIEDQEK*KLSK 278 + FA++ I KLSK Sbjct: 114 -----EAFASLRKSIPTMPSDKLSK 133 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 24.6 bits (51), Expect = 0.72 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 464 FHKQKIYFHYPFDFYFHSL 408 FH Q Y HYP ++Y H L Sbjct: 440 FHNQ--YAHYPAEYYGHHL 456 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -1 Query: 654 PFVERVTFLWCL 619 P ERV ++WCL Sbjct: 124 PSAERVAWMWCL 135 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -1 Query: 654 PFVERVTFLWCL 619 P ERV ++WCL Sbjct: 124 PSAERVAWMWCL 135 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -1 Query: 654 PFVERVTFLWCL 619 P ERV ++WCL Sbjct: 124 PSAERVAWMWCL 135 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -1 Query: 654 PFVERVTFLWCL 619 P ERV ++WCL Sbjct: 124 PSAERVAWMWCL 135 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = +3 Query: 12 PRAPPKLKTQQSNNKRIREPNEEDLKQSNKKT 107 P P LK+++ NN + ++++ +KT Sbjct: 77 PSELPALKSRKLNNNNVVSSTNQEIRGPKRKT 108 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 410 VNENKNQKDSENIFSVCENHTEF 478 V E+ N I + CE++T+F Sbjct: 26 VMEDANNLTQSTILTTCESNTDF 48 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,879 Number of Sequences: 336 Number of extensions: 2553 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -