BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00893 (723 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4257| Best HMM Match : Collagen (HMM E-Value=0.00073) 29 2.9 SB_14112| Best HMM Match : Amino_oxidase (HMM E-Value=3.3e-13) 29 3.8 >SB_4257| Best HMM Match : Collagen (HMM E-Value=0.00073) Length = 863 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -3 Query: 178 TSLYGHQIYKTSILTKFFFCTGNRALIHRCTYISMVCHFVV 56 +S Y Q T IL FFFC G+ R TY S++ ++++ Sbjct: 96 SSAYQRQNLFTIILISFFFCVGHCLRAPRGTY-SVIANYII 135 >SB_14112| Best HMM Match : Amino_oxidase (HMM E-Value=3.3e-13) Length = 482 Score = 29.1 bits (62), Expect = 3.8 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -1 Query: 444 ITS*KGVAIHKKRSCSLYVFVQITVYIRTVTPDRWC*WKRLSNQNTK 304 I+ KG+A H+ R CS + T TPDR +++L+ K Sbjct: 94 ISDMKGIACHQTRQCSRACTCMSAQDMETYTPDRTNLYQKLTEMKQK 140 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,904,519 Number of Sequences: 59808 Number of extensions: 388414 Number of successful extensions: 701 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -