BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00893 (723 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY089501-1|AAL90239.1| 603|Drosophila melanogaster GH11862p pro... 29 8.5 AE014134-1419|AAF52613.2| 1093|Drosophila melanogaster CG8475-PA... 29 8.5 >AY089501-1|AAL90239.1| 603|Drosophila melanogaster GH11862p protein. Length = 603 Score = 28.7 bits (61), Expect = 8.5 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Frame = +1 Query: 280 NIYCLCKLFCILVRESFPSAPPVRGYGSNINSYLNEHI*RAASF-----FMYCDTLL 435 +IYCLC+L+ I++ P G N+N+ L + RA S YC +LL Sbjct: 229 SIYCLCQLWGIILNR---EGPHFEVNGLNVNTALTQLYHRAGSLRYWRAVRYCSSLL 282 >AE014134-1419|AAF52613.2| 1093|Drosophila melanogaster CG8475-PA, isoform A protein. Length = 1093 Score = 28.7 bits (61), Expect = 8.5 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Frame = +1 Query: 280 NIYCLCKLFCILVRESFPSAPPVRGYGSNINSYLNEHI*RAASF-----FMYCDTLL 435 +IYCLC+L+ I++ P G N+N+ L + RA S YC +LL Sbjct: 719 SIYCLCQLWGIILNR---EGPHFEVNGLNVNTALTQLYHRAGSLRYWRAVRYCSSLL 772 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,458,469 Number of Sequences: 53049 Number of extensions: 549015 Number of successful extensions: 1066 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1066 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3231892257 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -