BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00893 (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 24 1.7 AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin prot... 23 2.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.9 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 8.9 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 8.9 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.8 bits (49), Expect = 1.7 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -2 Query: 587 NEVCQVR*YQIKQTFNYKDKCRVLSESRLKIALHPSKCMNSTVHF 453 N C V+ +IK + +Y L+ + PSKC ++VH+ Sbjct: 329 NSRCSVKREKIKISVSYPST-ETLNTKCNTLERTPSKCSQTSVHY 372 >AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin protein. Length = 124 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 644 NKRNPSDGGHIKGKTK*LFSFNSEHF 721 +KR P+ ++GK K S NSE+F Sbjct: 27 DKRAPTGHQEMQGKEKNSASLNSENF 52 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 74 HRDIGTPMNQCTVASAKKKFSQN 142 H+D TP +Q SAK K SQ+ Sbjct: 502 HQDSATPADQPLDLSAKPKNSQD 524 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -2 Query: 131 IFFLHWQPCI 102 + FL+W PCI Sbjct: 334 VVFLYWLPCI 343 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 597 IEAQRSLPGQIVPNKTDL 544 +E +S PG++VP + DL Sbjct: 48 VEELKSKPGKLVPLQCDL 65 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,708 Number of Sequences: 438 Number of extensions: 3770 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -