BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00892 (745 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 9e-23 SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) 70 2e-12 SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) 70 2e-12 SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) 70 2e-12 SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) 70 2e-12 SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) 70 2e-12 SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) 70 2e-12 SB_58649| Best HMM Match : Histone (HMM E-Value=4.5e-12) 69 3e-12 SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) 69 4e-12 SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) 68 9e-12 SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) 66 3e-11 SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) 66 3e-11 SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) 66 4e-11 SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) 66 4e-11 SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) 63 2e-10 SB_44162| Best HMM Match : Histone (HMM E-Value=0.00016) 62 5e-10 SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) 55 5e-08 SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) 55 5e-08 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 45 6e-05 SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) 44 1e-04 SB_50166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_58451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_44025| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_38686| Best HMM Match : 7tm_1 (HMM E-Value=5.70048e-42) 29 3.0 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_20073| Best HMM Match : F5_F8_type_C (HMM E-Value=2.9e-18) 29 5.3 SB_10439| Best HMM Match : Metallothio_7 (HMM E-Value=3.6) 29 5.3 SB_6273| Best HMM Match : MAM (HMM E-Value=0) 29 5.3 SB_16639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_22486| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_27184| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-05) 28 9.2 SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) 28 9.2 SB_30088| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_22305| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 104 bits (249), Expect = 9e-23 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK Sbjct: 96 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 145 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGV 360 + G DLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGV Sbjct: 139 LAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGV 180 >SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 70.1 bits (164), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 70.1 bits (164), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 134 Score = 70.1 bits (164), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 31 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 79 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 73 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 127 >SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 70.1 bits (164), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 393 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 441 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 435 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 489 >SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 70.1 bits (164), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 70.1 bits (164), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 59.3 bits (137), Expect = 3e-09 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ ATIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGATIAQGGVLPNIQASLLPKK 119 >SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 54.4 bits (125), Expect = 9e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA G V+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGRVLPNIQASLLPKK 119 >SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 126 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) Length = 863 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 760 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 808 Score = 56.4 bits (130), Expect = 2e-08 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L++ TIA GGV+P+I L+ KK Sbjct: 802 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLRGVTIAQGGVLPNIQAVLLPKK 856 >SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.7 bits (163), Expect = 2e-12 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_58649| Best HMM Match : Histone (HMM E-Value=4.5e-12) Length = 74 Score = 69.3 bits (162), Expect = 3e-12 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFP+GRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPIGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 >SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 986 Score = 69.3 bits (162), Expect = 3e-12 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPV R+HR+L+ + T H R+ A A VY AA++EYLTAE+LELAGNA++ Sbjct: 658 LQFPVSRVHRYLR-KCTHHYRISAAAPVYQAAVMEYLTAEILELAGNAAR 706 Score = 56.4 bits (130), Expect = 2e-08 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGG 402 + G D K RI PRH+ LA+ DEEL L+K TIA GGV+P+IH L+ K+ G Sbjct: 700 LAGNAARDNKKTRIIPRHILLAVANDEELHKLLKGVTIASGGVLPNIHPELLKKRKG 756 >SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNAS 253 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA+ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAA 70 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAACDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) Length = 125 Score = 67.7 bits (158), Expect = 9e-12 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHRHL+ + RVGA A V+ AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVHLAAVLEYLSAEILELAGNAAR 71 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 330 Score = 66.1 bits (154), Expect = 3e-11 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 66.1 bits (154), Expect = 3e-11 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 54.0 bits (124), Expect = 1e-07 Identities = 28/55 (50%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 119 >SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 125 Score = 66.1 bits (154), Expect = 3e-11 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 54.0 bits (124), Expect = 1e-07 Identities = 28/55 (50%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 119 >SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 66.1 bits (154), Expect = 3e-11 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) Length = 125 Score = 65.7 bits (153), Expect = 4e-11 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRVHRFLRKGNYAK-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 54.0 bits (124), Expect = 1e-07 Identities = 28/55 (50%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TI+ GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTISQGGVLPNIQAVLLPKK 119 >SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) Length = 126 Score = 65.7 bits (153), Expect = 4e-11 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHR L+ + RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRLLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) Length = 126 Score = 63.3 bits (147), Expect = 2e-10 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 256 LQFPVGRIHR L+ + RVGA VY AA+LEYL+AE+LELAGNA++ Sbjct: 23 LQFPVGRIHRLLRKGNYAE-RVGAGDPVYMAAVLEYLSAEILELAGNAAR 71 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_44162| Best HMM Match : Histone (HMM E-Value=0.00016) Length = 67 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELA 241 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELA Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELA 66 >SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGGPG 408 + G D K RI PRHLQLA+R DEEL+ L++ TIA GGV+P+I L+ KK G Sbjct: 29 LAGNAARDNKKSRIVPRHLQLAVRNDEELNKLLQGVTIAQGGVLPNIQAVLLPKKSNTG 87 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 167 RVGATAAVYSAAILEYLTAEVLELAGNASK 256 RVGA A VY AA+LEYLTAE+LELAGNA++ Sbjct: 6 RVGAGAPVYMAAVLEYLTAEILELAGNAAR 35 >SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) Length = 76 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 15 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 69 Score = 36.3 bits (80), Expect = 0.026 Identities = 15/20 (75%), Positives = 20/20 (100%) Frame = +2 Query: 197 AAILEYLTAEVLELAGNASK 256 AA+LEYL+AE+LELAGNA++ Sbjct: 2 AAVLEYLSAEILELAGNAAR 21 >SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) Length = 90 Score = 55.2 bits (127), Expect = 5e-08 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 396 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 29 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 83 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +2 Query: 167 RVGATAAVYSAAILEYLTAEVLELAGNASK 256 RVGA A VY AA+LEYL+AE+LELAGNA++ Sbjct: 6 RVGAGAPVYMAAVLEYLSAEILELAGNAAR 35 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 45.2 bits (102), Expect = 6e-05 Identities = 24/43 (55%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = +1 Query: 235 VGGKCV*DLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGV 360 + G D K RI PRHLQLA+R DEEL+ L+ TIA GGV Sbjct: 12 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGV 54 Score = 31.9 bits (69), Expect = 0.56 Identities = 13/17 (76%), Positives = 17/17 (100%) Frame = +2 Query: 206 LEYLTAEVLELAGNASK 256 LEYL+AE+LELAGNA++ Sbjct: 2 LEYLSAEILELAGNAAR 18 >SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAIL 208 LQFPVGRIHRHL+ + RVGA A VY AA+L Sbjct: 96 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVL 128 >SB_50166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 35.9 bits (79), Expect = 0.035 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +1 Query: 295 LAIRGDEELDSLIKA-TIAGGGVIPHIHKSLIGKK 396 LA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 1 LAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 35 >SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = +2 Query: 107 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVL 232 L FPVGRI R L + + RV AA+Y AA LEY+ E + Sbjct: 72 LVFPVGRIFRWLLDMKVAC-RVYDAAAIYLAATLEYIAEETI 112 >SB_58451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 495 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -3 Query: 680 FKCPMNKQKLSLILIQSYFKSPYSLHISITYSYIFSPDQQF-QSHHCPLH 534 F P + L S F P+S+ ISI S +++ +QF Q HH +H Sbjct: 295 FGTPSKDNGFTSFLFVSSFVIPFSILISIYLSILWTARKQFRQVHHAKIH 344 >SB_44025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 107 LQFPVGRIHRHL 142 LQFPVGRIHRHL Sbjct: 23 LQFPVGRIHRHL 34 >SB_38686| Best HMM Match : 7tm_1 (HMM E-Value=5.70048e-42) Length = 366 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 338 QLSLAEASSHTYTNLSLERKAVLVHPFNFKL 430 Q +L S T+T ++LER ++HPF KL Sbjct: 119 QDALVSVSVFTFTAIALERYRAIIHPFKPKL 149 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 268 SLLNLRRISRQLQNLCCKIFQNSGRINC-CRSSYAPVAC-CPILK 140 S +LR I+ QLQN CK+F + +C S + C CP K Sbjct: 179 SFASLRTITEQLQNSVCKLFAMAPYSDCEADKSSGVITCKCPDCK 223 >SB_20073| Best HMM Match : F5_F8_type_C (HMM E-Value=2.9e-18) Length = 593 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +1 Query: 274 ITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGGPG 408 +T +H+ + R + LIK + G H+H+ L G++ G Sbjct: 207 LTAKHINITNRTANVVKKLIKIGLLTNGSTTHVHRFLKGQRNNTG 251 >SB_10439| Best HMM Match : Metallothio_7 (HMM E-Value=3.6) Length = 288 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -2 Query: 486 CARCVTTAGIKCSIILSSHN--LKLNGCTRTAFLS 388 CARCVT G C + ++ + + +NGC + L+ Sbjct: 244 CARCVTMNGCACCVTMNGYPRCVTMNGCACSVTLN 278 >SB_6273| Best HMM Match : MAM (HMM E-Value=0) Length = 4272 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +1 Query: 199 RYFGISYSRGFGVGGKCV*DL-KVKRITPRHLQLAIRGDEELDSL 330 RY + SRG+G GG C K+ I H L GD +D L Sbjct: 2725 RYDDLCRSRGWGAGGMCPPIFSKIVVIKGNHYSLGALGDIAIDDL 2769 >SB_16639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +2 Query: 338 QLSLAEASSHTYTNLSLERKAVLVHPFNFKL*DDKIIL 451 Q +L S +T+ ++LER +++PF KL K+++ Sbjct: 115 QDALVSVSVYTFVVIALERYRAIINPFKPKLSKSKVLI 152 >SB_22486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/48 (35%), Positives = 29/48 (60%) Frame = +2 Query: 350 AEASSHTYTNLSLERKAVLVHPFNFKL*DDKIILHLIPAVVTHLAQII 493 A ++S T T LSL+R V++HPF +L +I + ++ + LA +I Sbjct: 118 ATSASLTLTVLSLDRYRVIMHPFQERLTRTQIKILILFSHSLSLALVI 165 >SB_27184| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-05) Length = 170 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +2 Query: 347 LAEASSHTYTNLSLERKAVLVHP--FNFKL*DDKI 445 L ASS T T L++ER +VHP FKL D + Sbjct: 91 LTTASSFTLTVLAVERYQAIVHPMCMRFKLRDGAV 125 >SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) Length = 1602 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 316 ELDSLIKATIAGGGVIPHIHKSLIGKKGGP 405 ++ S++K TI+ + H+H +IG +G P Sbjct: 307 DMKSMLKLTISIASGLAHLHMEIIGTQGKP 336 >SB_30088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = -2 Query: 450 SIILSSHNLKLNGCTRT---AFLSNERFVYVWDDASASDSCFYEAVQFFISSNSK 295 +++ +S NL LN C+ T AF+ N+ ++ W + S + ++ F SS S+ Sbjct: 206 ALLRTSENL-LNNCSNTRIDAFIDNQALLFSWHKQVSKSSEISDIMKKFSSSYSR 259 >SB_22305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = -2 Query: 450 SIILSSHNLKLNGCTRT---AFLSNERFVYVWDDASASDSCFYEAVQFFISSNSK 295 +++ +S NL LN C+ T AF+ N+ ++ W + S + ++ F SS S+ Sbjct: 255 ALLRTSENL-LNNCSNTRIDAFIDNQALLFSWHKQVSKSSEISDIMKKFSSSYSR 308 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,622,179 Number of Sequences: 59808 Number of extensions: 471611 Number of successful extensions: 1224 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 1007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1147 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -