BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00889 (769 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC869.05c |||sulfate transporter |Schizosaccharomyces pombe|ch... 26 6.8 SPAC1B3.02c |||transcription elongation factor, Elf1 family|Schi... 25 9.0 SPAC977.10 |sod2||CPA1 sodium ion/proton antiporter |Schizosacch... 25 9.0 >SPAC869.05c |||sulfate transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 840 Score = 25.8 bits (54), Expect = 6.8 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 6/71 (8%) Frame = +1 Query: 574 TRVVYYI-NTIIIPKHDHAVRAFLRPMRCDVLVFELTKKRAPWLILPVVICLSQRLSH-- 744 T YYI N I+ HAV + PM+ +L + L A + V++ + + + Sbjct: 464 TDAFYYIPNAILSAVIIHAVTDLILPMKQTILFWRLQPLEACIFFISVIVSVFSSIENGI 523 Query: 745 ---ACLSASVL 768 CL+A++L Sbjct: 524 YVSVCLAAALL 534 >SPAC1B3.02c |||transcription elongation factor, Elf1 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 107 Score = 25.4 bits (53), Expect = 9.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 80 SPQCIYVKLLTGQDIYERWIDTSD 9 S QC+ L D+Y WID D Sbjct: 55 SHQCLITALSAPIDVYSDWIDACD 78 >SPAC977.10 |sod2||CPA1 sodium ion/proton antiporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 468 Score = 25.4 bits (53), Expect = 9.0 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +1 Query: 268 DGMFVRLVHF*FQNETIKRTNAPVRSVVYVILYVPCAILKFYSLKRIIIFHMVFLFKH 441 DGM V +F + T+K + R V +++ CA F+ +I + + F+ KH Sbjct: 178 DGMAVPFFYFAIKLLTVKPSRNAGRDWVLLVVLYECAFGIFFGC--VIGYLLSFILKH 233 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,740,282 Number of Sequences: 5004 Number of extensions: 49786 Number of successful extensions: 76 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -