BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00888 (755 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0505 - 4005211-4005234,4005235-4005432,4005522-4006006,400... 28 7.0 02_02_0351 + 9257204-9261388 28 9.2 >12_01_0505 - 4005211-4005234,4005235-4005432,4005522-4006006, 4006533-4006700,4007128-4007203,4007327-4007409, 4007511-4007589,4007685-4007753,4008174-4008266, 4008668-4008713,4009398-4009522 Length = 481 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = -1 Query: 584 IEDVNVRKEHPIRTDHVCCSVSNINCTAHLASTLK*ELR 468 ++ + + K HP+ H+C + N N T+ ++T + LR Sbjct: 283 LDMLELNKGHPLYLSHLCSKMKNANVTSAKSNTFQLFLR 321 >02_02_0351 + 9257204-9261388 Length = 1394 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = +1 Query: 361 LQTSLPQFYYLNFLKLMFNVRILNRDLNNIL 453 L ++ +FY+L FL L ++ IL +D+N+++ Sbjct: 680 LPNAVSRFYHLKFLDLGYSKCILPKDINHLV 710 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,743,095 Number of Sequences: 37544 Number of extensions: 337234 Number of successful extensions: 552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -