BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00886 (678 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g23130.2 68417.m03334 receptor-like protein kinase 6 (RLK6) i... 27 8.6 At4g23130.1 68417.m03333 receptor-like protein kinase 6 (RLK6) i... 27 8.6 >At4g23130.2 68417.m03334 receptor-like protein kinase 6 (RLK6) identical to receptor-like protein kinase 6 [Arabidopsis thaliana] GI:13506749; contains Pfam domain PF00069: Protein kinase domain Length = 663 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/46 (26%), Positives = 26/46 (56%) Frame = -2 Query: 407 LTILIQMKDSSAYFPSLMTRTMMRNNLVYFRILTILIQMKDSSAYF 270 L + Q++D + Y + T + RN++ + + T+L + ++AYF Sbjct: 20 LRVSAQLQDPT-YVGHVCTNRISRNSIYFSNLQTLLTSLSSNNAYF 64 >At4g23130.1 68417.m03333 receptor-like protein kinase 6 (RLK6) identical to receptor-like protein kinase 6 [Arabidopsis thaliana] GI:13506749; contains Pfam domain PF00069: Protein kinase domain Length = 659 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/46 (26%), Positives = 26/46 (56%) Frame = -2 Query: 407 LTILIQMKDSSAYFPSLMTRTMMRNNLVYFRILTILIQMKDSSAYF 270 L + Q++D + Y + T + RN++ + + T+L + ++AYF Sbjct: 20 LRVSAQLQDPT-YVGHVCTNRISRNSIYFSNLQTLLTSLSSNNAYF 64 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,503,643 Number of Sequences: 28952 Number of extensions: 147769 Number of successful extensions: 379 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 379 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -