BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00885 (724 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.13 |||tRNA |Schizosaccharomyces pombe|chr 3|||Manual 27 3.6 SPBC16A3.12c |||triglyceride lipase-cholesterol esterase |Schizo... 27 3.6 SPBC13E7.07 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 4.7 SPCC4B3.04c |nte1||lysophospholipase|Schizosaccharomyces pombe|c... 26 6.3 >SPCC18.13 |||tRNA |Schizosaccharomyces pombe|chr 3|||Manual Length = 421 Score = 26.6 bits (56), Expect = 3.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 116 SKMQKQVPAKGKKRKANTNLVTSEPKNVKQNSLVNSDNKNSI 241 SK+QK P G +V P+N K+ ++ SD I Sbjct: 166 SKLQKLEPIMGHVSILTQLIVAQNPQNSKEEIIITSDKDEHI 207 >SPBC16A3.12c |||triglyceride lipase-cholesterol esterase |Schizosaccharomyces pombe|chr 2|||Manual Length = 443 Score = 26.6 bits (56), Expect = 3.6 Identities = 7/18 (38%), Positives = 15/18 (83%) Frame = -1 Query: 232 FIIRVNQRVLFHIFRFRC 179 +I++VN ++++H+F RC Sbjct: 252 YIVKVNPKIMYHLFGRRC 269 >SPBC13E7.07 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 26.2 bits (55), Expect = 4.7 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = +2 Query: 71 ANFFGTVNYHYY*FISKMQKQV--PAKGKKRKANTNLVTSEPKNVKQNSLVNSD 226 A TV YY +S +K P K K K + KN K+++LVN + Sbjct: 11 AFLIATVYVAYYFLVSSDKKLATKPQKSKLTKLGKQKQRQKQKNTKKDTLVNRE 64 >SPCC4B3.04c |nte1||lysophospholipase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1316 Score = 25.8 bits (54), Expect = 6.3 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 89 VNYHYY*FISKMQKQVPAKGKKRKANTNLVTSEPKNVKQNSL 214 V Y Y +++ + P K K +TN+ SEP+ QN L Sbjct: 82 VRYRYLNKYARLPHEAPIKEAKLGPDTNIRPSEPRIGFQNYL 123 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,077,479 Number of Sequences: 5004 Number of extensions: 31770 Number of successful extensions: 60 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -