BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00885 (724 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02040.1 68417.m00274 expressed protein 29 4.1 At5g11270.1 68418.m01316 expressed protein 28 7.2 >At4g02040.1 68417.m00274 expressed protein Length = 152 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 119 KMQKQVPAKGKKRKANTNLVTSEPKNVKQNSLVNSDNKN 235 + +KQ P K AN NLV + K +K+ +++ NKN Sbjct: 37 RRRKQSPTVVKSPAANPNLVMEQVKILKRGETLSAFNKN 75 >At5g11270.1 68418.m01316 expressed protein Length = 354 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 140 AKGKKRKANTNLVTSEPKNVKQNSLVNSDN 229 A+GK RK + +S PK K+ SL +DN Sbjct: 59 ARGKNRKGFVSSSSSSPKKNKKKSLDGADN 88 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,476,072 Number of Sequences: 28952 Number of extensions: 154660 Number of successful extensions: 338 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 338 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -