BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00884 (753 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-l... 56 2e-08 At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-l... 56 2e-08 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 56 3e-08 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 54 8e-08 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 44 8e-05 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 42 3e-04 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 42 3e-04 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 42 3e-04 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 42 4e-04 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 42 4e-04 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 42 6e-04 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 41 0.001 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 40 0.002 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 38 0.009 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 38 0.009 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 36 0.022 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 36 0.022 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 36 0.038 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 36 0.038 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 35 0.050 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 35 0.050 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 35 0.067 At2g47310.1 68415.m05906 flowering time control protein-related ... 34 0.12 At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly id... 33 0.15 At2g37340.2 68415.m04579 splicing factor RSZ33 (RSZ33) nearly id... 33 0.15 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 33 0.27 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 33 0.27 At1g43190.1 68414.m04977 polypyrimidine tract-binding protein, p... 33 0.27 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 33 0.27 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 32 0.36 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 32 0.36 At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein... 32 0.36 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 32 0.36 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 32 0.36 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 32 0.36 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 32 0.36 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 32 0.47 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 32 0.47 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 32 0.47 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 31 0.82 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 31 0.82 At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RS... 31 1.1 At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing ... 31 1.1 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 31 1.1 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 31 1.1 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 31 1.1 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 31 1.1 At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing ... 31 1.1 At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing ... 31 1.1 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 30 1.4 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 30 1.4 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 30 1.4 At5g12190.1 68418.m01430 RNA recognition motif (RRM)-containing ... 30 1.9 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 30 1.9 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 30 1.9 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 29 2.5 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 29 2.5 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 29 2.5 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 29 2.5 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 29 3.3 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 29 3.3 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 29 3.3 At5g12080.2 68418.m01415 mechanosensitive ion channel domain-con... 29 4.4 At5g12080.1 68418.m01414 mechanosensitive ion channel domain-con... 29 4.4 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 29 4.4 At1g78410.1 68414.m09137 VQ motif-containing protein contains PF... 29 4.4 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 29 4.4 At4g25500.2 68417.m03674 arginine/serine-rich splicing factor RS... 28 5.8 At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing ... 28 5.8 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 28 5.8 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 28 5.8 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 28 5.8 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 28 5.8 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 28 5.8 At5g10350.2 68418.m01201 polyadenylate-binding protein family pr... 28 7.7 At5g10350.1 68418.m01200 polyadenylate-binding protein family pr... 28 7.7 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 28 7.7 At3g05760.1 68416.m00647 expressed protein 28 7.7 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 28 7.7 At1g06960.2 68414.m00741 small nuclear ribonucleoprotein U2B, pu... 28 7.7 At1g06960.1 68414.m00740 small nuclear ribonucleoprotein U2B, pu... 28 7.7 >At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 56.4 bits (130), Expect = 2e-08 Identities = 23/42 (54%), Positives = 31/42 (73%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVE 252 +VYVGNL ++ E+E F +G +RNVWVAR PPG+AF+E Sbjct: 3 RVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLE 44 >At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 56.4 bits (130), Expect = 2e-08 Identities = 23/42 (54%), Positives = 31/42 (73%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVE 252 +VYVGNL ++ E+E F +G +RNVWVAR PPG+AF+E Sbjct: 3 RVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLE 44 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 56.0 bits (129), Expect = 3e-08 Identities = 22/46 (47%), Positives = 33/46 (71%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVELKTP 264 +VYVGNL ++ E+E F +G +R+VWVAR PPG+AF++ + P Sbjct: 3 RVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPGYAFLDFEDP 48 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 255 EDPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 EDPRDA D++R LDG G R+ + G Sbjct: 46 EDPRDARDAIRALDGKN--GWRVEQSHNRG 73 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 54.4 bits (125), Expect = 8e-08 Identities = 22/44 (50%), Positives = 32/44 (72%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVELK 258 +VYVGNL ++ E+E F +G IR+VWVAR PPG+AF++ + Sbjct: 3 RVYVGNLDPRVTERELEDEFRSFGVIRSVWVARRPPGYAFLDFE 46 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 44.4 bits (100), Expect = 8e-05 Identities = 21/47 (44%), Positives = 30/47 (63%), Gaps = 2/47 (4%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVELKTP 264 +YVGNL + K E+E +F KYG I ++ + PPG+AFVE + P Sbjct: 9 IYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRPPGYAFVEFEDP 55 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = +3 Query: 255 EDPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 EDPRDA+D++ G DG G R+RVE+++G Sbjct: 53 EDPRDADDAIYGRDGYDFDGCRLRVEIAHG 82 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/43 (48%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVE 252 VYVGNL + + E+E +FSKYG + + V PPG+AFVE Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVE 51 Score = 35.9 bits (79), Expect = 0.029 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = +3 Query: 255 EDPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 +D RDAED++ G DG G R+RVE+++G Sbjct: 53 DDARDAEDAIHGRDGYDFDGHRLRVELAHG 82 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/43 (48%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVE 252 VYVGNL + + E+E +FSKYG + + V PPG+AFVE Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVE 51 Score = 35.9 bits (79), Expect = 0.029 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = +3 Query: 255 EDPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 +D RDAED++ G DG G R+RVE+++G Sbjct: 53 DDARDAEDAIHGRDGYDFDGHRLRVELAHG 82 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/43 (48%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVE 252 VYVGNL + + E+E +FSKYG + + V PPG+AFVE Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVE 51 Score = 35.9 bits (79), Expect = 0.029 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = +3 Query: 255 EDPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 +D RDAED++ G DG G R+RVE+++G Sbjct: 53 DDARDAEDAIHGRDGYDFDGHRLRVELAHG 82 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVELK 258 +YVGNL + + E+E +FSKYG + + + PPG+AFVE + Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFE 53 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 255 EDPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 ED RDA+D++ G DG G +RVE+++G Sbjct: 53 EDARDADDAIYGRDGYDFDGHHLRVELAHG 82 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVELK 258 +YVGNL + + E+E +FSKYG + + + PPG+AFVE + Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFE 53 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 255 EDPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 ED RDA+D++ G DG G +RVE+++G Sbjct: 53 EDARDADDAIYGRDGYDFDGHHLRVELAHG 82 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/57 (35%), Positives = 35/57 (61%) Frame = +1 Query: 94 MSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVELKTP 264 M RY + + ++YVG L + ++E++FS+YG +R+V + R+ +AFVE P Sbjct: 1 MPRYDDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD---YAFVEFSDP 54 Score = 32.3 bits (70), Expect = 0.36 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +3 Query: 258 DPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 DPRDA+D+ LDG G+RI VE S G Sbjct: 53 DPRDADDARYYLDGRDFDGSRITVEASRG 81 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/57 (35%), Positives = 35/57 (61%) Frame = +1 Query: 94 MSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVELKTP 264 M RY + + ++YVG L + ++E++FS+YG +R+V + R+ +AFVE P Sbjct: 1 MPRYDDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD---YAFVEFGDP 54 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +3 Query: 258 DPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 DPRDA+D+ LDG G+RI VE S G Sbjct: 53 DPRDADDARHYLDGRDFDGSRITVEFSRG 81 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +3 Query: 240 CICRIEDPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 C E RDAED+++G DG G R+RVE+++G Sbjct: 48 CFVEFEHSRDAEDAIKGRDGYNLDGCRLRVELAHG 82 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = +1 Query: 121 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVELK 258 S +YVGNL + ++EIE IF KYG I ++ V PP + FVE + Sbjct: 6 SRSIYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPPRPPCYCFVEFE 53 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 4/52 (7%) Frame = +1 Query: 118 LSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVAR----NPPGFAFVELKT 261 L K++VG L N S+ E++ +FSKYG I+++ + R G AF++ +T Sbjct: 104 LEHKLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYET 155 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 4/52 (7%) Frame = +1 Query: 118 LSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVAR----NPPGFAFVELKT 261 L K++VG L N S+ E++ +FSKYG I+++ + R G AF++ +T Sbjct: 104 LEHKLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYET 155 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 36.3 bits (80), Expect = 0.022 Identities = 15/43 (34%), Positives = 30/43 (69%) Frame = +1 Query: 100 RYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN 228 R R L K++VG+L A++ E+E+IF ++G++ +V++ R+ Sbjct: 203 RERIGTLEFKLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRD 245 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 36.3 bits (80), Expect = 0.022 Identities = 15/43 (34%), Positives = 30/43 (69%) Frame = +1 Query: 100 RYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN 228 R R L K++VG+L A++ E+E+IF ++G++ +V++ R+ Sbjct: 203 RERIGTLEFKLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRD 245 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 35.5 bits (78), Expect = 0.038 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP----PGFAFVE 252 ++YVGNL N S+ ++ K+F +G++ V V R+ GF FV+ Sbjct: 286 RLYVGNLHINMSEDDLRKVFESFGSVELVQVPRDETGLCKGFGFVQ 331 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 35.5 bits (78), Expect = 0.038 Identities = 17/49 (34%), Positives = 30/49 (61%), Gaps = 4/49 (8%) Frame = +1 Query: 91 KMSRYREWDLSC----KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVAR 225 ++ R D SC K++VG L N S+ E++ +FS+YG I+++ + R Sbjct: 94 ELERLDVLDCSCNPEHKLFVGMLPKNVSETEVQSLFSEYGTIKDLQILR 142 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 35.1 bits (77), Expect = 0.050 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 5/65 (7%) Frame = +1 Query: 115 DLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP-----PGFAFVELKTPVMLKT 279 D KVYVGNL +K +E +FS+ G + + V+R P GF FV + ++ Sbjct: 174 DSPYKVYVGNLAKTVTKEMLENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEA 233 Query: 280 LFVDL 294 V L Sbjct: 234 AIVAL 238 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 35.1 bits (77), Expect = 0.050 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = +1 Query: 118 LSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVAR 225 L K++VG L N S+ E++ +FS+YG I+++ + R Sbjct: 98 LEHKLFVGMLPKNVSETEVQSLFSEYGTIKDLQILR 133 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 34.7 bits (76), Expect = 0.067 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = +1 Query: 115 DLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVELKT 261 D C ++VG L + ++ + ++ SKYG I+N+ + R+ G+ FVE +T Sbjct: 61 DPYCTLFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYET 114 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 33.9 bits (74), Expect = 0.12 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNV 213 K+YV + A++Y+I ++F KYGN+ + Sbjct: 111 KLYVAPISKTATEYDIRQVFEKYGNVTEI 139 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 4/52 (7%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP----PGFAFVELKTPVM 270 K+YV L +K E+ ++FS+YG I ++++A + G+AFV+ M Sbjct: 208 KLYVRCLNKQTTKMEVNEVFSRYGIIEDIYMALDDMKICRGYAFVQFSCKEM 259 >At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 249 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +3 Query: 258 DPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 DPRDA+D+ LDG G+RI VE S G Sbjct: 12 DPRDADDARHYLDGRDFDGSRITVEFSRG 40 >At2g37340.2 68415.m04579 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 260 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +3 Query: 258 DPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 DPRDA+D+ LDG G+RI VE S G Sbjct: 23 DPRDADDARHYLDGRDFDGSRITVEFSRG 51 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 5/55 (9%) Frame = +1 Query: 106 REWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEL 255 R +D + ++YVGNL + +E++FS++G + + V + GF FV++ Sbjct: 201 RVYDAAFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQM 255 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 32.7 bits (71), Expect = 0.27 Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +1 Query: 124 CK-VYVGNLGTNASKYEIEKIFSKYGNIRN 210 CK ++VG +G N SK ++E+ FSK+G I + Sbjct: 249 CKSLWVGGIGPNVSKDDLEEEFSKFGKIED 278 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/43 (30%), Positives = 27/43 (62%) Frame = +1 Query: 121 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFV 249 S ++VG+L ++ ++ ++F +YG+I + V + GFAF+ Sbjct: 17 SNNLWVGSLTPETTESDLTELFGRYGDIDRITV-YSSRGFAFI 58 >At1g43190.1 68414.m04977 polypyrimidine tract-binding protein, putative / heterogeneous nuclear ribonucleoprotein, putative similar to Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) from {Rattus norvegicus} SP|Q00438, {Homo sapiens} SP|P26599, [Homo sapiens] GI:35770; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 432 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 124 CKVYVGNLGTNA-SKYEIEKIFSKYGNIRNVWVARNPPGFAFVEL 255 C V V NL ++ + ++ +FS YGNI + + RN P A V++ Sbjct: 245 CTVLVSNLNADSIDEDKLFNLFSLYGNIVRIKLLRNKPDHALVQM 289 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 32.7 bits (71), Expect = 0.27 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 4/62 (6%) Frame = +1 Query: 91 KMSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPP----GFAFVELK 258 +++R+ E +Y+ NL + +++++FS+YGN+ + V NP GF FV Sbjct: 322 RINRF-EKSQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQGMSRGFGFVAYS 380 Query: 259 TP 264 P Sbjct: 381 NP 382 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPG 237 VYV NL + E+ K F K+G I + V R+ G Sbjct: 231 VYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQSG 266 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 32.3 bits (70), Expect = 0.36 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 136 VGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFV 249 VGN+ +N YE++ +F ++G+I+ + A GF V Sbjct: 221 VGNISSNVEDYELKVLFEQFGDIQALHTACKNRGFIMV 258 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 32.3 bits (70), Expect = 0.36 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 5/47 (10%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP-----PGFAFVE 252 K+YVGNL N S+ ++ +IF +G + V + +P GF F++ Sbjct: 266 KLYVGNLHFNMSELQLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQ 312 >At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 243 Score = 32.3 bits (70), Expect = 0.36 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +3 Query: 258 DPRDAEDSVRGLDGTRCCGTRIRVEMSNG 344 DPRDA+D+ LDG G+RI VE S G Sbjct: 12 DPRDADDARYYLDGRDFDGSRITVEASRG 40 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 32.3 bits (70), Expect = 0.36 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFV 249 VYVGN + ++E++FSK+G ++ V + G+AFV Sbjct: 4 VYVGNFDYDTRHSDLERLFSKFGRVKRVDM---KSGYAFV 40 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 32.3 bits (70), Expect = 0.36 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP 231 +++VG+L AS+ +++K+F G + V + +NP Sbjct: 215 EIFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNP 249 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 32.3 bits (70), Expect = 0.36 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 5/55 (9%) Frame = +1 Query: 100 RYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIR--NVWVARN---PPGFAFV 249 R + +L +++VG L + ++ ++E F +YG I + V R+ P GF F+ Sbjct: 4 RENDGNLESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFI 58 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 32.3 bits (70), Expect = 0.36 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 5/55 (9%) Frame = +1 Query: 100 RYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIR--NVWVARN---PPGFAFV 249 R + +L +++VG L + ++ ++E F +YG I + V R+ P GF F+ Sbjct: 4 RENDGNLESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFI 58 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 31.9 bits (69), Expect = 0.47 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 5/50 (10%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVELKTP 264 +Y+G + + EIE FS++G ++ V VARN F F++ + P Sbjct: 62 LYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFEDP 111 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 31.9 bits (69), Expect = 0.47 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = +1 Query: 121 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP----PGFAFVELKTP 264 S +YV NL + S ++++IFS +G + + V R+P G FV TP Sbjct: 131 SSNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPNGTSKGSGFVAFATP 182 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 31.9 bits (69), Expect = 0.47 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPG----FAFVELKTP 264 VYV NL + E++K F KYG+I + V ++ G F FV +P Sbjct: 227 VYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQSGNSRSFGFVNFVSP 275 Score = 31.5 bits (68), Expect = 0.62 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +1 Query: 91 KMSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPP----GFAFVELK 258 ++SR+ + S +Y+ NL + + +++++FS+YGN+ + V N GF FV Sbjct: 318 RISRFEKLQGS-NLYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNSQGLSRGFGFVAYS 376 Query: 259 TP 264 P Sbjct: 377 NP 378 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 31.1 bits (67), Expect = 0.82 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVELK 258 V+ GN +A + ++E++F KYG + V + GFAFV ++ Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDM---KAGFAFVYME 43 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +3 Query: 252 IEDPRDAEDSVRGLDGTRC--CGTRIRVE 332 +ED RDAED++R LD G R+RVE Sbjct: 42 MEDERDAEDAIRALDRFEYGRTGRRLRVE 70 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 31.1 bits (67), Expect = 0.82 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVELK 258 V+ GN +A + ++E++F KYG + V + GFAFV ++ Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDM---KAGFAFVYME 43 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +3 Query: 252 IEDPRDAEDSVRGLDGTRC--CGTRIRVE 332 +ED RDAED++R LD G R+RVE Sbjct: 42 MEDERDAEDAIRALDRFEYGRTGRRLRVE 70 >At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 350 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVELK 258 V+ GN +A + ++E++F KYG + V + GFAFV ++ Sbjct: 4 VFCGNFEYDAREGDLERLFRKYGKVERVDM---KAGFAFVYME 43 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +3 Query: 252 IEDPRDAEDSVRGLDGTRC--CGTRIRVE 332 +ED RDAED++R LD G R+RVE Sbjct: 42 MEDERDAEDAIRALDRFEFGRKGRRLRVE 70 >At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing protein contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 173 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 5/52 (9%) Frame = +1 Query: 121 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVELKT 261 +C VY+GN+ S + I + G + ++ + R+ P GFAF E +T Sbjct: 6 NCTVYIGNVDERVSDRVLYDIMIQAGRVIDLHIPRDKETDKPKGFAFAEYET 57 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 163 KYEIEKIFSKYGNIRNVWVARNPPGFAFVELKT 261 +++IEK F YG + NV + RN F+FV+ +T Sbjct: 107 EHDIEKHFEPYGKVTNVRIRRN---FSFVQFET 136 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFV 249 V+VGN + ++E++F KYG + V + G+AFV Sbjct: 4 VFVGNFEYETRQSDLERLFDKYGRVDRVDM---KSGYAFV 40 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVELKTPVMLKTLFVD 291 K+++G L + + K F KYG I + + R+ P GF F+ P ++ + D Sbjct: 20 KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIED 79 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN 228 K++VG + + ++ E++ F+KYGN+ V R+ Sbjct: 110 KIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRD 143 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVELKTPVMLKTLFVD 291 K+++G L + + K F KYG I + + R+ P GF F+ P ++ + D Sbjct: 20 KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIED 79 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN 228 K++VG + + ++ E++ F+KYGN+ V R+ Sbjct: 110 KIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRD 143 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 4/71 (5%) Frame = +1 Query: 64 FYPPFSIKTKMSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPG-- 237 F PF K + + VYV NL + E++ F +YG+I + V R+ G Sbjct: 205 FVGPFLRKEERESAADKMKFTNVYVKNLSEATTDDELKTTFGQYGSISSAVVMRDGDGKS 264 Query: 238 --FAFVELKTP 264 F FV + P Sbjct: 265 RCFGFVNFENP 275 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPG 237 +YV NL + ++ ++F+++G I + V R+P G Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGTITSCKVMRDPSG 365 >At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFV 249 ++V N+ +N E+ +F +YG+IR ++ GF + Sbjct: 170 LFVRNINSNVEDSELTALFEQYGDIRTLYTTCKHRGFVMI 209 >At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFV 249 ++V N+ +N E+ +F +YG+IR ++ GF + Sbjct: 170 LFVRNINSNVEDSELTALFEQYGDIRTLYTTCKHRGFVMI 209 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVELKTPVMLKTL 282 V+VGNL K I K FSK+G + +V + P + K +MLK + Sbjct: 173 VFVGNLPLKVKKKVILKEFSKFGEVESVRIRSVPIVDSKRTRKGAIMLKQI 223 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = +1 Query: 115 DLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFV 249 D + K++VG L + E K F KYG I + + ++ P GF FV Sbjct: 39 DSAGKIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFV 88 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 118 LSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN 228 ++ +VYVGNL + + + FS YGN+ + V R+ Sbjct: 1 MATRVYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRD 37 >At5g12190.1 68418.m01430 RNA recognition motif (RRM)-containing protein similar to SP|P52298 20 kDa nuclear cap binding protein (NCBP 20 kDa subunit) (CBP20) (NCBP interacting protein 1) (NIP1) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 124 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVA--RNPPGFAFV 249 +YV NL N + E+ IF KYG IR + + + G AFV Sbjct: 21 LYVRNLPFNITSEEMYDIFGKYGAIRQIRIGCDKATKGTAFV 62 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNV 213 ++V NL ++ S E+ IFS YG IR V Sbjct: 297 LWVNNLDSSISNEELHGIFSSYGEIREV 324 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 5/46 (10%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVAR-----NPPGFAFV 249 K++VG + S+ +++ FS+YG + VA+ P GF FV Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFV 52 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = +1 Query: 121 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN----PPGFAFVE 252 S +YVGN+ + E+++ F G + V + + P GFA+VE Sbjct: 102 SRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAYVE 149 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNV-----WVARNPPGFAFVELKT 261 K++VGNL N ++ ++F GN+ V V GF FV + T Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMST 149 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNV-----WVARNPPGFAFVELKT 261 K++VGNL N ++ ++F GN+ V V GF FV + T Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMST 149 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 5/54 (9%) Frame = +1 Query: 115 DLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVW-----VARNPPGFAFVELKT 261 D +++ NL + +K E+++ F+ +G + ++ V + P G AFV+ KT Sbjct: 558 DFERTLFIRNLPFDVTKEEVKQRFTVFGEVESLSLVLHKVTKRPEGTAFVKFKT 611 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 5/48 (10%) Frame = +1 Query: 121 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWV-----ARNPPGFAFV 249 S VY+GN+ ++ ++ ++FS+ G I+ + + + P GF FV Sbjct: 33 STTVYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLDKNTKTPCGFCFV 80 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +1 Query: 106 REWDLSCKVYVGNLGTNASKYEIEKIFSKYGNI 204 R ++ + +VYVGNL + +E++FS++G + Sbjct: 238 RVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKV 270 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGN--IRNVWVARNPPGFAFVELKTPV 267 VYVGNL S+ ++ + F G I V V R+ GF FV T V Sbjct: 262 VYVGNLAPEVSQVDLHRHFHSLGAGVIEEVRVQRD-KGFGFVRYSTHV 308 >At5g12080.2 68418.m01415 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 734 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +2 Query: 14 VVASD*KIKFSEIL*IIFIHPFQSKLRCLATENGIFLAKCTWATWVLMRLNMK*KKYFLN 193 ++ S K F I+ + +HP+ RC+ + + + T V ++LN + K Y+ N Sbjct: 554 IIGSTCKNLFESIVFVFVMHPYDVGDRCVVDGVAMLVEEMNLLTTVFLKLNNE-KVYYPN 612 Query: 194 TV 199 V Sbjct: 613 AV 614 >At5g12080.1 68418.m01414 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 734 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +2 Query: 14 VVASD*KIKFSEIL*IIFIHPFQSKLRCLATENGIFLAKCTWATWVLMRLNMK*KKYFLN 193 ++ S K F I+ + +HP+ RC+ + + + T V ++LN + K Y+ N Sbjct: 554 IIGSTCKNLFESIVFVFVMHPYDVGDRCVVDGVAMLVEEMNLLTTVFLKLNNE-KVYYPN 612 Query: 194 TV 199 V Sbjct: 613 AV 614 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 5/61 (8%) Frame = +1 Query: 82 IKTKMSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAF 246 I + S + ++ S VYVG + + ++ ++ +FS+YG I +V + R+ GFAF Sbjct: 22 ISDEASWHAKYKNSAYVYVGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGKSKGFAF 81 Query: 247 V 249 + Sbjct: 82 L 82 >At1g78410.1 68414.m09137 VQ motif-containing protein contains PF05678: VQ motif Length = 108 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 480 VIVNGGEKESDGELKATVVETLTGRESMIGGGDYD 376 V +N E+D TVV+ LTG+ +++ G +D Sbjct: 15 VFINTQYVETDARSFKTVVQELTGKNAIVAAGPFD 49 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = +1 Query: 121 SCKVYVGNLGTNASKYEIEKIFSKYGNI--RNVWVAR---NPPGFAFV 249 S K++VG + + ++ + + FSKYG + + V R GFAFV Sbjct: 33 SSKIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFV 80 >At4g25500.2 68417.m03674 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 309 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +3 Query: 252 IEDPRDAEDSVRGLDGTRC--CGTRIRVE 332 +ED RDAED++R LD G R+RVE Sbjct: 1 MEDERDAEDAIRALDRFEFGRKGRRLRVE 29 >At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, gb:D86122 Length = 785 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -2 Query: 311 TAACSIKSTNRVFSITGVFNSTNANPGGFRATHTLRMLPYLENIFSISYLD 159 +A ++K+ NR ++ PGG R L+M P LE S SYL+ Sbjct: 270 SADAALKALNRTEIAGKRIKLEHSRPGGARRNMMLQMNPELEQDDSYSYLN 320 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 136 VGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVE 252 V NL + S ++E IF YG I+ + N FVE Sbjct: 226 VFNLAPSVSNRDLENIFGVYGEIKEIRETPNKRHHKFVE 264 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 5/54 (9%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVELKTPVML 273 K++VG + + ++ + F+ YG + V R+ P GF FV P +L Sbjct: 7 KLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVL 60 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 28.3 bits (60), Expect = 5.8 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = +1 Query: 121 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN----PPGFAFVELKTP 264 S VYV NL + + +FS+YG + +V V R+ GF FV P Sbjct: 201 STNVYVKNLIETVTDDCLHTLFSQYGTVSSVVVMRDGMGRSRGFGFVNFCNP 252 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNV-----WVARNPPGFAFVELKT 261 K+YV L ++ + F ++GN+ ++ VA P GFAF+ +T Sbjct: 78 KLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYET 127 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGN--IRNVWVARNPPGFAFVELKT 261 VYVGNL ++ ++ ++F G I V V R+ GF FV T Sbjct: 275 VYVGNLSPEVTQLDLHRLFYTLGAGVIEEVRVQRD-KGFGFVRYNT 319 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGN--IRNVWVARNPPGFAFVELKT 261 VYVGNL ++ ++ ++F G I V V R+ GF FV T Sbjct: 271 VYVGNLSPEVTQLDLHRLFYTLGAGVIEEVRVQRD-KGFGFVRYNT 315 >At5g10350.2 68418.m01201 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN----PPGFAFVE 252 VYVGN+ + E++ F G + V + + P GFA+VE Sbjct: 91 VYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKFGQPKGFAYVE 135 >At5g10350.1 68418.m01200 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 217 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN----PPGFAFVE 252 VYVGN+ + E++ F G + V + + P GFA+VE Sbjct: 91 VYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKFGQPKGFAYVE 135 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/60 (20%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = +1 Query: 127 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVELKTPVMLKTLFVD 291 K+++G + + + +++ F KYG++ + R+ GF F+ P + + + +D Sbjct: 16 KLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVIMD 75 >At3g05760.1 68416.m00647 expressed protein Length = 202 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 234 RICICRIEDPRDAEDSVRGLDGTRCCGTRIRVEMSN 341 R+C C ++D + D + G R G +RVE S+ Sbjct: 86 RVCDCVVKDSANYLDHINGKKHQRALGMSMRVERSS 121 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRN--VWVARN--PPGFAFVELKT 261 +YV NL + ++E++FS++G I + V V N G FVE T Sbjct: 225 LYVKNLDDSVDNTKLEELFSEFGTITSCKVMVHSNGISKGVGFVEFST 272 >At1g06960.2 68414.m00741 small nuclear ribonucleoprotein U2B, putative / spliceosomal protein, putative non-consensus splice donor GC at exon 4; similar to spliceosomal protein (U2B) GI:169588 from [Solanum tuberosum] Length = 228 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVELKTPV 267 +++ NL + ++ +F +Y + + + PG AFVE + V Sbjct: 156 LFIHNLPIETNSMMLQLLFEQYPGFKEIRMIEAKPGIAFVEYEDDV 201 >At1g06960.1 68414.m00740 small nuclear ribonucleoprotein U2B, putative / spliceosomal protein, putative non-consensus splice donor GC at exon 4; similar to spliceosomal protein (U2B) GI:169588 from [Solanum tuberosum] Length = 229 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +1 Query: 130 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVELKTPV 267 +++ NL + ++ +F +Y + + + PG AFVE + V Sbjct: 157 LFIHNLPIETNSMMLQLLFEQYPGFKEIRMIEAKPGIAFVEYEDDV 202 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,393,246 Number of Sequences: 28952 Number of extensions: 282531 Number of successful extensions: 991 Number of sequences better than 10.0: 81 Number of HSP's better than 10.0 without gapping: 915 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 984 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -