BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00883 (788 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q16RN6 Cluster: Adp,atp carrier protein; n=1; Aedes aeg... 65 2e-09 UniRef50_P12236 Cluster: ADP/ATP translocase 3; n=11; Euteleosto... 62 1e-08 UniRef50_P05141 Cluster: ADP/ATP translocase 2; n=61; Eukaryota|... 61 4e-08 UniRef50_P12235 Cluster: ADP/ATP translocase 1; n=108; Eukaryota... 60 6e-08 UniRef50_Q9H0C2 Cluster: ADP/ATP translocase 4; n=17; Eukaryota|... 55 2e-06 UniRef50_Q8LFZ1 Cluster: ADP/ATP translocase-like protein; n=10;... 43 0.010 UniRef50_P91270 Cluster: Putative uncharacterized protein F25B4.... 41 0.041 UniRef50_Q18683 Cluster: Putative uncharacterized protein; n=2; ... 38 0.29 UniRef50_Q76KG1 Cluster: ADP/ATP carrier protein; n=1; Penicilli... 36 1.5 UniRef50_Q21809 Cluster: Putative uncharacterized protein; n=2; ... 35 2.7 UniRef50_UPI00006CFCC1 Cluster: hypothetical protein TTHERM_0059... 34 4.7 UniRef50_P04710 Cluster: ADP,ATP carrier protein 1; n=163; Eukar... 33 6.2 >UniRef50_Q16RN6 Cluster: Adp,atp carrier protein; n=1; Aedes aegypti|Rep: Adp,atp carrier protein - Aedes aegypti (Yellowfever mosquito) Length = 257 Score = 65.3 bits (152), Expect = 2e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL Sbjct: 222 KQEGTGAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 257 Score = 38.7 bits (86), Expect = 0.16 Identities = 14/18 (77%), Positives = 18/18 (100%) Frame = +2 Query: 2 KSDILYKNTIHCWATIAK 55 K++I+YK+TIHCWATIAK Sbjct: 205 KTEIIYKSTIHCWATIAK 222 >UniRef50_P12236 Cluster: ADP/ATP translocase 3; n=11; Euteleostomi|Rep: ADP/ATP translocase 3 - Homo sapiens (Human) Length = 298 Score = 62.5 bits (145), Expect = 1e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 +D G AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 263 RDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >UniRef50_P05141 Cluster: ADP/ATP translocase 2; n=61; Eukaryota|Rep: ADP/ATP translocase 2 - Homo sapiens (Human) Length = 298 Score = 60.9 bits (141), Expect = 4e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKK 153 +D G AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 263 RDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >UniRef50_P12235 Cluster: ADP/ATP translocase 1; n=108; Eukaryota|Rep: ADP/ATP translocase 1 - Homo sapiens (Human) Length = 298 Score = 60.1 bits (139), Expect = 6e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKK 153 +D G AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 263 KDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >UniRef50_Q9H0C2 Cluster: ADP/ATP translocase 4; n=17; Eukaryota|Rep: ADP/ATP translocase 4 - Homo sapiens (Human) Length = 315 Score = 54.8 bits (126), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKK 153 Q G +FF+GAFSNVLRGTGGA VLVLYD+IK+ Sbjct: 273 QHEGISSFFRGAFSNVLRGTGGALVLVLYDKIKE 306 >UniRef50_Q8LFZ1 Cluster: ADP/ATP translocase-like protein; n=10; Eukaryota|Rep: ADP/ATP translocase-like protein - Arabidopsis thaliana (Mouse-ear cress) Length = 330 Score = 42.7 bits (96), Expect = 0.010 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G +F++GA SN+ R TG A +LV YDE+K+ L Sbjct: 290 RSEGLASFYRGALSNMFRSTGSAAILVFYDEVKRFL 325 >UniRef50_P91270 Cluster: Putative uncharacterized protein F25B4.7; n=2; Caenorhabditis|Rep: Putative uncharacterized protein F25B4.7 - Caenorhabditis elegans Length = 306 Score = 40.7 bits (91), Expect = 0.041 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +1 Query: 61 GNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 G AFF GA N +RGTG A VL +Y+E++K + Sbjct: 274 GPKAFFHGALVNAIRGTGAALVLAIYNELQKYM 306 >UniRef50_Q18683 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 306 Score = 37.9 bits (84), Expect = 0.29 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 55 DRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKK 153 + G +KGA +N+ R GGA V+ LY+EI K Sbjct: 272 EEGVRGLYKGALANIFRSAGGALVMALYEEIHK 304 >UniRef50_Q76KG1 Cluster: ADP/ATP carrier protein; n=1; Penicillium chrysogenum|Rep: ADP/ATP carrier protein - Penicillium chrysogenum (Penicillium notatum) Length = 430 Score = 35.5 bits (78), Expect = 1.5 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = +1 Query: 61 GNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 G + FKGA +N+LRG GA VL +YD+ + +L Sbjct: 393 GVKSLFKGAGANILRGVAGAGVLSIYDKAQMLL 425 >UniRef50_Q21809 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 298 Score = 34.7 bits (76), Expect = 2.7 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 73 FFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 F++GA +N LR TGGA ++ Y E K + Sbjct: 270 FYRGALTNSLRSTGGALIITFYYEFSKYM 298 >UniRef50_UPI00006CFCC1 Cluster: hypothetical protein TTHERM_00599880; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00599880 - Tetrahymena thermophila SB210 Length = 662 Score = 33.9 bits (74), Expect = 4.7 Identities = 21/58 (36%), Positives = 32/58 (55%) Frame = -3 Query: 450 KKTNHFSF*IKNRLYNMKAIEMSKLENFQRGPISLQLEQPIM*HLIKQ*IMESLYNTL 277 KKT+ SF KN+ N K EM KL++F S Q+ + + L+ ++E+ Y TL Sbjct: 95 KKTSATSFNAKNQKGNFKIHEMFKLDDFLNSKKSHQITKSDVSGLLNNHLIENEYETL 152 >UniRef50_P04710 Cluster: ADP,ATP carrier protein 1; n=163; Eukaryota|Rep: ADP,ATP carrier protein 1 - Saccharomyces cerevisiae (Baker's yeast) Length = 309 Score = 33.5 bits (73), Expect = 6.2 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 Q G + FKG +N+ RG A V+ LYD+++ ++ Sbjct: 268 QKEGAYSLFKGCGANIFRGVAAAGVISLYDQLQLIM 303 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 689,243,761 Number of Sequences: 1657284 Number of extensions: 12469188 Number of successful extensions: 23614 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 22897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23609 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 67085240885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -