BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00883 (788 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 58 4e-10 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 58 4e-10 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 58 4e-10 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 25 2.0 AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long fo... 25 3.5 Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor pr... 24 6.2 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 24 6.2 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 57.6 bits (133), Expect = 4e-10 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G+ AFFKGAFSNVLRGTGGA VLV YDE+K +L Sbjct: 265 KQEGSGAFFKGAFSNVLRGTGGALVLVFYDEVKALL 300 Score = 31.5 bits (68), Expect = 0.031 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 2 KSDILYKNTIHCWATIAK 55 KS+++YKNT+ CW I K Sbjct: 248 KSEVMYKNTLDCWVKIGK 265 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 57.6 bits (133), Expect = 4e-10 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G+ AFFKGAFSNVLRGTGGA VLV YDE+K +L Sbjct: 265 KQEGSGAFFKGAFSNVLRGTGGALVLVFYDEVKALL 300 Score = 31.5 bits (68), Expect = 0.031 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 2 KSDILYKNTIHCWATIAK 55 KS+++YKNT+ CW I K Sbjct: 248 KSEVMYKNTLDCWVKIGK 265 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 57.6 bits (133), Expect = 4e-10 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G+ AFFKGAFSNVLRGTGGA VLV YDE+K +L Sbjct: 265 KQEGSGAFFKGAFSNVLRGTGGALVLVFYDEVKALL 300 Score = 31.5 bits (68), Expect = 0.031 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 2 KSDILYKNTIHCWATIAK 55 KS+++YKNT+ CW I K Sbjct: 248 KSEVMYKNTLDCWVKIGK 265 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 25.4 bits (53), Expect = 2.0 Identities = 14/60 (23%), Positives = 27/60 (45%) Frame = +1 Query: 79 KGAFSNVLRGTGGAFVLVLYDEIKKVL*I*RKNCYHNFYVIPCRSHSPQIMYY*TRKRLS 258 +G +L +V+ Y+ ++ L R+NCY+ +Y YY +KR++ Sbjct: 167 RGVSKFILASEPHRYVVQRYESSEEELYARRQNCYYYYYYNEEEDDDTYQDYYSCKKRIA 226 >AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long form protein. Length = 311 Score = 24.6 bits (51), Expect = 3.5 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = +2 Query: 290 NDSIIYCFIKCYIIG 334 ND++ +C++KC + G Sbjct: 63 NDAVTHCYVKCTLAG 77 >Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor protein. Length = 327 Score = 23.8 bits (49), Expect = 6.2 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -3 Query: 750 KSQMSALHNQLQNHMDFTFNSIMCTEVKNTLHNYVKL 640 K+ ++ +L +HM F F I + ++T +YVK+ Sbjct: 31 KTYYASSTGRLGSHMPFNFRLITEVDKQSTAADYVKV 67 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.8 bits (49), Expect = 6.2 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 602 ELRISTFSYTAGVSLT*LCSVFLTSVHIMLLNVK 703 ELR+ T + + L LCS+ + H+ +++ K Sbjct: 122 ELRLRTKAQVIAILLPILCSLSVAITHVTMVDFK 155 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,593 Number of Sequences: 2352 Number of extensions: 14365 Number of successful extensions: 71 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -