BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00883 (788 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y10618-2|CAA71628.1| 299|Drosophila melanogaster ADP/ATP transl... 65 1e-10 BT011069-1|AAR31140.1| 299|Drosophila melanogaster GH27591p pro... 65 1e-10 AY070894-1|AAL48516.1| 299|Drosophila melanogaster LP02726p pro... 65 1e-10 AY060978-1|AAL28526.1| 299|Drosophila melanogaster GM12886p pro... 65 1e-10 AE014298-1497|AAF47957.1| 299|Drosophila melanogaster CG16944-P... 65 1e-10 AE014298-1496|AAG22341.1| 299|Drosophila melanogaster CG16944-P... 65 1e-10 AE014298-1495|AAN09268.1| 312|Drosophila melanogaster CG16944-P... 65 1e-10 AE014298-1494|AAN09267.1| 312|Drosophila melanogaster CG16944-P... 65 1e-10 S43651-1|AAB23114.1| 297|Drosophila melanogaster ADP/ATP transl... 62 6e-10 S71762-1|AAB31734.3| 297|Drosophila melanogaster ADP/ATP transl... 62 8e-10 Y10618-1|CAA71629.1| 307|Drosophila melanogaster ADP/ATP transl... 52 9e-07 AE014298-1493|AAO41648.1| 307|Drosophila melanogaster CG1683-PB... 52 9e-07 AE014298-1492|AAF47956.1| 307|Drosophila melanogaster CG1683-PA... 52 9e-07 AE014296-2499|ABI31254.1| 1063|Drosophila melanogaster CG7255-PH... 30 3.1 AE014296-2498|ABC66142.1| 1063|Drosophila melanogaster CG7255-PF... 30 3.1 AE014296-2497|ABI31255.1| 607|Drosophila melanogaster CG7255-PG... 30 3.1 >Y10618-2|CAA71628.1| 299|Drosophila melanogaster ADP/ATP translocase protein. Length = 299 Score = 64.9 bits (151), Expect = 1e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G AFFKGAFSN+LRGTGGAFVLVLYDEIKKVL Sbjct: 264 KQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKVL 299 Score = 37.5 bits (83), Expect = 0.021 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +2 Query: 5 SDILYKNTIHCWATIAK 55 ++++YKNT+HCWATIAK Sbjct: 248 TEVIYKNTLHCWATIAK 264 >BT011069-1|AAR31140.1| 299|Drosophila melanogaster GH27591p protein. Length = 299 Score = 64.9 bits (151), Expect = 1e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G AFFKGAFSN+LRGTGGAFVLVLYDEIKKVL Sbjct: 264 KQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKVL 299 Score = 37.5 bits (83), Expect = 0.021 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +2 Query: 5 SDILYKNTIHCWATIAK 55 ++++YKNT+HCWATIAK Sbjct: 248 TEVIYKNTLHCWATIAK 264 >AY070894-1|AAL48516.1| 299|Drosophila melanogaster LP02726p protein. Length = 299 Score = 64.9 bits (151), Expect = 1e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G AFFKGAFSN+LRGTGGAFVLVLYDEIKKVL Sbjct: 264 KQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKVL 299 Score = 37.5 bits (83), Expect = 0.021 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +2 Query: 5 SDILYKNTIHCWATIAK 55 ++++YKNT+HCWATIAK Sbjct: 248 TEVIYKNTLHCWATIAK 264 >AY060978-1|AAL28526.1| 299|Drosophila melanogaster GM12886p protein. Length = 299 Score = 64.9 bits (151), Expect = 1e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G AFFKGAFSN+LRGTGGAFVLVLYDEIKKVL Sbjct: 264 KQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKVL 299 Score = 37.5 bits (83), Expect = 0.021 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +2 Query: 5 SDILYKNTIHCWATIAK 55 ++++YKNT+HCWATIAK Sbjct: 248 TEVIYKNTLHCWATIAK 264 >AE014298-1497|AAF47957.1| 299|Drosophila melanogaster CG16944-PB, isoform B protein. Length = 299 Score = 64.9 bits (151), Expect = 1e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G AFFKGAFSN+LRGTGGAFVLVLYDEIKKVL Sbjct: 264 KQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKVL 299 Score = 37.5 bits (83), Expect = 0.021 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +2 Query: 5 SDILYKNTIHCWATIAK 55 ++++YKNT+HCWATIAK Sbjct: 248 TEVIYKNTLHCWATIAK 264 >AE014298-1496|AAG22341.1| 299|Drosophila melanogaster CG16944-PA, isoform A protein. Length = 299 Score = 64.9 bits (151), Expect = 1e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G AFFKGAFSN+LRGTGGAFVLVLYDEIKKVL Sbjct: 264 KQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKVL 299 Score = 37.5 bits (83), Expect = 0.021 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +2 Query: 5 SDILYKNTIHCWATIAK 55 ++++YKNT+HCWATIAK Sbjct: 248 TEVIYKNTLHCWATIAK 264 >AE014298-1495|AAN09268.1| 312|Drosophila melanogaster CG16944-PD, isoform D protein. Length = 312 Score = 64.9 bits (151), Expect = 1e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G AFFKGAFSN+LRGTGGAFVLVLYDEIKKVL Sbjct: 277 KQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKVL 312 Score = 37.5 bits (83), Expect = 0.021 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +2 Query: 5 SDILYKNTIHCWATIAK 55 ++++YKNT+HCWATIAK Sbjct: 261 TEVIYKNTLHCWATIAK 277 >AE014298-1494|AAN09267.1| 312|Drosophila melanogaster CG16944-PC, isoform C protein. Length = 312 Score = 64.9 bits (151), Expect = 1e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G AFFKGAFSN+LRGTGGAFVLVLYDEIKKVL Sbjct: 277 KQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKVL 312 Score = 37.5 bits (83), Expect = 0.021 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +2 Query: 5 SDILYKNTIHCWATIAK 55 ++++YKNT+HCWATIAK Sbjct: 261 TEVIYKNTLHCWATIAK 277 >S43651-1|AAB23114.1| 297|Drosophila melanogaster ADP/ATP translocase protein. Length = 297 Score = 62.5 bits (145), Expect = 6e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 70 AFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 +FFKGAFSN+LRGTGGAFVLVLYDEIKKVL Sbjct: 268 SFFKGAFSNILRGTGGAFVLVLYDEIKKVL 297 Score = 37.5 bits (83), Expect = 0.021 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +2 Query: 5 SDILYKNTIHCWATIAK 55 ++++YKNT+HCWATIAK Sbjct: 247 TEVIYKNTLHCWATIAK 263 >S71762-1|AAB31734.3| 297|Drosophila melanogaster ADP/ATP translocase protein. Length = 297 Score = 62.1 bits (144), Expect = 8e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 73 FFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 FFKGAFSN+LRGTGGAFVLVLYDEIKKVL Sbjct: 269 FFKGAFSNILRGTGGAFVLVLYDEIKKVL 297 Score = 37.5 bits (83), Expect = 0.021 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +2 Query: 5 SDILYKNTIHCWATIAK 55 ++++YKNT+HCWATIAK Sbjct: 247 TEVIYKNTLHCWATIAK 263 >Y10618-1|CAA71629.1| 307|Drosophila melanogaster ADP/ATP translocase protein. Length = 307 Score = 52.0 bits (119), Expect = 9e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 70 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 153 AFFKGA SN++RGTGGA VL LYDE+KK Sbjct: 278 AFFKGALSNIIRGTGGALVLALYDEMKK 305 Score = 34.3 bits (75), Expect = 0.19 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 2 KSDILYKNTIHCWATIAK 55 KS+++YKNT HCW IAK Sbjct: 255 KSEMVYKNTAHCWLVIAK 272 >AE014298-1493|AAO41648.1| 307|Drosophila melanogaster CG1683-PB, isoform B protein. Length = 307 Score = 52.0 bits (119), Expect = 9e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 70 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 153 AFFKGA SN++RGTGGA VL LYDE+KK Sbjct: 278 AFFKGALSNIIRGTGGALVLALYDEMKK 305 Score = 34.3 bits (75), Expect = 0.19 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 2 KSDILYKNTIHCWATIAK 55 KS+++YKNT HCW IAK Sbjct: 255 KSEMVYKNTAHCWLVIAK 272 >AE014298-1492|AAF47956.1| 307|Drosophila melanogaster CG1683-PA, isoform A protein. Length = 307 Score = 52.0 bits (119), Expect = 9e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 70 AFFKGAFSNVLRGTGGAFVLVLYDEIKK 153 AFFKGA SN++RGTGGA VL LYDE+KK Sbjct: 278 AFFKGALSNIIRGTGGALVLALYDEMKK 305 Score = 34.3 bits (75), Expect = 0.19 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 2 KSDILYKNTIHCWATIAK 55 KS+++YKNT HCW IAK Sbjct: 255 KSEMVYKNTAHCWLVIAK 272 >AE014296-2499|ABI31254.1| 1063|Drosophila melanogaster CG7255-PH, isoform H protein. Length = 1063 Score = 30.3 bits (65), Expect = 3.1 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 484 YVINLISVCAGAKAELKIV*NFMLKEVFNVLSILNLSFVG 603 YVI SVC G L + N LK F ++ +N+SF+G Sbjct: 121 YVIGTASVCRGISLYLDSLLNDTLKYTFAEVAPMNVSFLG 160 >AE014296-2498|ABC66142.1| 1063|Drosophila melanogaster CG7255-PF, isoform F protein. Length = 1063 Score = 30.3 bits (65), Expect = 3.1 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 484 YVINLISVCAGAKAELKIV*NFMLKEVFNVLSILNLSFVG 603 YVI SVC G L + N LK F ++ +N+SF+G Sbjct: 121 YVIGTASVCRGISLYLDSLLNDTLKYTFAEVAPMNVSFLG 160 >AE014296-2497|ABI31255.1| 607|Drosophila melanogaster CG7255-PG, isoform G protein. Length = 607 Score = 30.3 bits (65), Expect = 3.1 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 484 YVINLISVCAGAKAELKIV*NFMLKEVFNVLSILNLSFVG 603 YVI SVC G L + N LK F ++ +N+SF+G Sbjct: 121 YVIGTASVCRGISLYLDSLLNDTLKYTFAEVAPMNVSFLG 160 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,261,813 Number of Sequences: 53049 Number of extensions: 587288 Number of successful extensions: 1051 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1010 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3654740856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -