BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00883 (788 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 43 3e-04 At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 33 0.22 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 32 0.38 At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri... 32 0.38 At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri... 32 0.38 At3g06370.1 68416.m00735 sodium proton exchanger, putative (NHX3... 28 6.1 At5g27150.1 68418.m03240 sodium proton exchanger / Na+/H+ antipo... 28 8.1 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 + G +F++GA SN+ R TG A +LV YDE+K+ L Sbjct: 290 RSEGLASFYRGALSNMFRSTGSAAILVFYDEVKRFL 325 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 ++ G + FKGA +N+LR GA VL YD+++ ++ Sbjct: 334 KNEGAKSLFKGAGANILRAVAGAGVLAGYDKLQLIV 369 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 32.3 bits (70), Expect = 0.38 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 61 GNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 G + FKGA +N+LR GA VL YD+++ ++ Sbjct: 343 GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIV 375 >At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 32.3 bits (70), Expect = 0.38 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 ++ G + FKGA +N+LR GA VL YD+++ ++ Sbjct: 336 KNEGAKSLFKGAGANILRAVAGAGVLSGYDKLQLIV 371 >At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 32.3 bits (70), Expect = 0.38 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +1 Query: 52 QDRGNLAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 159 ++ G + FKGA +N+LR GA VL YD+++ ++ Sbjct: 336 KNEGAKSLFKGAGANILRAVAGAGVLSGYDKLQLIV 371 >At3g06370.1 68416.m00735 sodium proton exchanger, putative (NHX3) similar to sodium proton exchanger (Nhx1) GB:AAD16946 [Arabidopsis thaliana]; Member of The Monovalent Cation:Proton Antiporter (CPA1) Family, PMID:11500563 Length = 503 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 544 NFMLKEVFNVLSILNLSFVGIENFHFFLHS 633 ++ML E+F++ SIL + F GI H+ H+ Sbjct: 264 SYMLAELFHLSSILTVFFCGIVMSHYTWHN 293 >At5g27150.1 68418.m03240 sodium proton exchanger / Na+/H+ antiporter (NHX1) identical to Na+/H+ exchanger [Arabidopsis thaliana] gi|6650177|gb|AAF21755 and sodium proton exchanger Nhx1 [Arabidopsis thaliana] gi|4324597|gb|AAD16946; Member of The Monovalent Cation:Proton Antiporter (CPA1) Family, PMID:11500563 Length = 538 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 544 NFMLKEVFNVLSILNLSFVGIENFHFFLHSGSE 642 ++ML E+F++ IL + F GI H+ H+ +E Sbjct: 261 SYMLAELFDLSGILTVFFCGIVMSHYTWHNVTE 293 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,062,301 Number of Sequences: 28952 Number of extensions: 277346 Number of successful extensions: 499 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 487 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 499 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1775300800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -