BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00882 (788 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59688| Best HMM Match : K-box (HMM E-Value=0.25) 30 1.9 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 29 4.3 SB_11216| Best HMM Match : GILT (HMM E-Value=6.7e-10) 28 9.9 >SB_59688| Best HMM Match : K-box (HMM E-Value=0.25) Length = 884 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +1 Query: 274 SFLVGSGESRSSDTKGLHFSRGESYSRSIRLRRCVPRDGDDQREPRTRLVHD 429 S L G GE RSS S ++ + I RR R+ D++ PR +L+++ Sbjct: 438 SSLTGGGEGRSSPELTRPLSEYKNLQKLIDDRRETERELDERMSPRAKLLYE 489 >SB_34190| Best HMM Match : MAM (HMM E-Value=0) Length = 384 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +1 Query: 262 HHGDSFLVGSGESRSSDTKGLHFS--RGESYSRSIRLRRCVPRDGD 393 +HG+ +L G + +SSDT + F RG SY I L R+GD Sbjct: 281 NHGNQWLQGLVDIKSSDTYQVMFEAIRGTSYYGDIALDDVTFRNGD 326 >SB_11216| Best HMM Match : GILT (HMM E-Value=6.7e-10) Length = 311 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +2 Query: 95 IFRTNTKIINI*NQDAVHYGDGKSEDAKSHEG*RRYC 205 ++ T+ KI NI + V +GDGK AKS G + YC Sbjct: 49 LYPTSNKIPNILDISMVPFGDGKEIKAKS--GFQYYC 83 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,883,997 Number of Sequences: 59808 Number of extensions: 391002 Number of successful extensions: 751 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -