Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00882
         (788 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF487781-1|AAL96668.1|  533|Anopheles gambiae cytochrome P450 CY...    24   6.2  
AF395080-1|AAK97462.1|  537|Anopheles gambiae zinc finger transc...    24   6.2  

>AF487781-1|AAL96668.1|  533|Anopheles gambiae cytochrome P450
           CYP9L1 protein protein.
          Length = 533

 Score = 23.8 bits (49), Expect = 6.2
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = -2

Query: 193 SSFVRFGILRLPITIMYGILILYINYFCVR 104
           S FVR    R P   MYG+  ++   F +R
Sbjct: 57  SEFVRSNYERFPNAKMYGMFEMFTPMFVIR 86


>AF395080-1|AAK97462.1|  537|Anopheles gambiae zinc finger
           transcription factor pannier protein.
          Length = 537

 Score = 23.8 bits (49), Expect = 6.2
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -1

Query: 173 HPQTSHHHNVRHP 135
           HP   HHH+  HP
Sbjct: 501 HPHHHHHHHHHHP 513


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 693,529
Number of Sequences: 2352
Number of extensions: 13092
Number of successful extensions: 17
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 82744797
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)