BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00882 (788 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006810-2|AAF59631.2| 297|Caenorhabditis elegans Hypothetical ... 29 2.9 Z77133-6|CAB00869.1| 338|Caenorhabditis elegans Hypothetical pr... 28 8.8 Z69794-6|CAA93683.1| 338|Caenorhabditis elegans Hypothetical pr... 28 8.8 >AC006810-2|AAF59631.2| 297|Caenorhabditis elegans Hypothetical protein Y5H2B.4 protein. Length = 297 Score = 29.5 bits (63), Expect = 2.9 Identities = 17/66 (25%), Positives = 28/66 (42%) Frame = -2 Query: 217 FSPYTVAPSSFVRFGILRLPITIMYGILILYINYFCVRTKNITGKCYST*FSTIKLLVIS 38 F P +V P + +G+ P+ + L I Y CV C+ ++T K +V Sbjct: 125 FFPNSVIPIIAIGYGVFEYPVLYSFCNFELNIPYGCVTLSCSLNLCFYQYWTTYKTIVYI 184 Query: 37 LVEMRT 20 L + T Sbjct: 185 LTFLST 190 >Z77133-6|CAB00869.1| 338|Caenorhabditis elegans Hypothetical protein R03G8.5 protein. Length = 338 Score = 27.9 bits (59), Expect = 8.8 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -2 Query: 154 TIMYGILILYINYFCVRTKNIT 89 T+++G+L++ +N FCVR IT Sbjct: 23 TLIFGLLLIILNIFCVRGVFIT 44 >Z69794-6|CAA93683.1| 338|Caenorhabditis elegans Hypothetical protein R03G8.5 protein. Length = 338 Score = 27.9 bits (59), Expect = 8.8 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -2 Query: 154 TIMYGILILYINYFCVRTKNIT 89 T+++G+L++ +N FCVR IT Sbjct: 23 TLIFGLLLIILNIFCVRGVFIT 44 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,308,756 Number of Sequences: 27780 Number of extensions: 287749 Number of successful extensions: 647 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 647 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1914239236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -