BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00882 (788 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g33720.1 68414.m04169 cytochrome P450, putative similar to SP... 28 8.1 At1g33410.1 68414.m04136 expressed protein 28 8.1 >At1g33720.1 68414.m04169 cytochrome P450, putative similar to SP|O64636 Cytochrome P450 76C1 (EC 1.14.-.-) {Arabidopsis thaliana}; contains Pfam profile PF00067: Cytochrome P450 Length = 511 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -2 Query: 307 SNDSLQIRRGSYHRGEGRFRSITSLARSSLFSPYTVAPSSFVR 179 SN+ + G H RFR + L+ + LFSP + + +R Sbjct: 113 SNNHHEFSVGWIHPSSSRFRMLRKLSATQLFSPQCIQATKALR 155 >At1g33410.1 68414.m04136 expressed protein Length = 1459 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -2 Query: 265 GEGRFRSITSLARSSLFSPYTVAPS 191 GEG ++++ SL++ + FSP T PS Sbjct: 898 GEGSWKALHSLSKEAGFSPATTGPS 922 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,336,494 Number of Sequences: 28952 Number of extensions: 264923 Number of successful extensions: 579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1775300800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -