BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00881 (690 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47305| Best HMM Match : I-set (HMM E-Value=0) 31 1.2 SB_22391| Best HMM Match : C1_1 (HMM E-Value=3.6e-17) 28 8.2 >SB_47305| Best HMM Match : I-set (HMM E-Value=0) Length = 5832 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/58 (34%), Positives = 28/58 (48%) Frame = -1 Query: 261 DANRVQRAASKTPQSRACGDYYHNYILLHRRDLVNDRYGLNTSSCDCLSIVLTTSLKF 88 D N++ S+ Q R+CGD YH IL + + T SC+ S + TS KF Sbjct: 5186 DGNKI--LTSRNVQIRSCGDVYHLIILFTKSE------HAGTYSCEATSKLGNTSAKF 5235 >SB_22391| Best HMM Match : C1_1 (HMM E-Value=3.6e-17) Length = 103 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 450 HYCKRI*QYDITTGLKLMSCNPSTHHEC 533 +YC ++ + I G+K +C HH+C Sbjct: 62 YYCNKLLKGFIKQGVKCKNCKMGVHHKC 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,739,036 Number of Sequences: 59808 Number of extensions: 386350 Number of successful extensions: 610 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -