BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00881 (690 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC026301-5|AAK68894.1| 745|Caenorhabditis elegans Hypothetical ... 29 4.1 >AC026301-5|AAK68894.1| 745|Caenorhabditis elegans Hypothetical protein Y54F10BM.3 protein. Length = 745 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 544 IIPVHSWCVLGLQLISFSPVVMSYCYIRLQ*WKSKNM 434 +IP+ W V+ +F +YCY ++Q W+ + M Sbjct: 185 LIPIEVWLVVLFLESAFVGAFGAYCYWKVQQWRDEKM 221 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,715,629 Number of Sequences: 27780 Number of extensions: 293302 Number of successful extensions: 614 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 614 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -