BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00878 (758 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0492 - 29769252-29769330,29769432-29769508,29769604-297697... 29 3.0 >01_06_0492 - 29769252-29769330,29769432-29769508,29769604-29769761, 29769879-29769964,29770058-29770085,29771223-29771730 Length = 311 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 220 AWKYYFLILNSTIYCNYAKLIRSYLS*KWFAL 315 +WK +L+L +T+ Y +I +YLS KW+ L Sbjct: 3 SWKDIYLVLEATVPL-YVAMILAYLSIKWWKL 33 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,048,165 Number of Sequences: 37544 Number of extensions: 352494 Number of successful extensions: 660 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -