BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00878 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 26 1.5 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 24 4.4 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 5.9 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 25.8 bits (54), Expect = 1.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 Query: 273 KIDKIVSLVKMVRPPAHPNSY 335 KI K+V + K +PP HP+++ Sbjct: 511 KIQKLVLIPKPGKPPGHPSAF 531 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 24.2 bits (50), Expect = 4.4 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -2 Query: 517 RNMKILWVCINCD 479 RN ++LW+C NC+ Sbjct: 77 RNNQLLWLCKNCN 89 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +2 Query: 542 YVKSKLIESWLVIHFISIVTL---FLENIII 625 Y++ + SW ++FIS+V L F+ N+I+ Sbjct: 346 YIEDAMGSSWQWVYFISMVILGAFFVMNLIL 376 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 777,249 Number of Sequences: 2352 Number of extensions: 14707 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -