BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00878 (758 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g20925.1 68414.m02620 auxin efflux carrier family protein con... 29 3.4 >At1g20925.1 68414.m02620 auxin efflux carrier family protein contains auxin efflux carrier domain, Pfam:PF03547 Length = 386 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +3 Query: 138 ARKKKNKLFYFAVNIFLGASIFIRTIRRVEILLSYFKLYNILQLRKIDKIVS--LVKMVR 311 ARK+ N + ++ + L AS TI ++ +F N+L I + ++K+ + Sbjct: 41 ARKQLNNIVFYVFSPSLVASSLSETITYESMVKMWFMPLNVLLTFIIGSFLGWIVIKITK 100 Query: 312 PPAH 323 PP+H Sbjct: 101 PPSH 104 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,929,404 Number of Sequences: 28952 Number of extensions: 313106 Number of successful extensions: 647 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 647 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -