BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00877 (768 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC31E1.04 |pep12||SNARE Pep12|Schizosaccharomyces pombe|chr 2|... 26 5.2 SPAC1B3.02c |||transcription elongation factor, Elf1 family|Schi... 25 9.0 >SPBC31E1.04 |pep12||SNARE Pep12|Schizosaccharomyces pombe|chr 2|||Manual Length = 317 Score = 26.2 bits (55), Expect = 5.2 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 293 ISNFRMKQSNGRMHLFVQSFTSFCTFRGAILKFYSLKRI 409 I+N +++ R F++SF F +FR Y+L I Sbjct: 230 IANEHSRKARKRSFCFLKSFAMFSSFRSQNANLYNLNSI 268 >SPAC1B3.02c |||transcription elongation factor, Elf1 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 107 Score = 25.4 bits (53), Expect = 9.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 80 SPQCIYVKLLTGQDIYERWIDTSD 9 S QC+ L D+Y WID D Sbjct: 55 SHQCLITALSAPIDVYSDWIDACD 78 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,782,420 Number of Sequences: 5004 Number of extensions: 51520 Number of successful extensions: 83 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -