BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00876 (721 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g43580.1 68414.m05003 expressed protein 34 0.082 At4g11910.1 68417.m01894 expressed protein hypothetical protein ... 33 0.25 At5g55400.1 68418.m06902 fimbrin-like protein, putative similar ... 31 0.58 At5g45080.1 68418.m05528 disease resistance protein-related weak... 31 0.77 At4g26700.1 68417.m03848 fimbrin-like protein (FIM1) identical t... 31 0.77 At4g33600.1 68417.m04773 expressed protein 31 1.0 At4g22920.1 68417.m03310 expressed protein 30 1.3 At1g33670.1 68414.m04165 leucine-rich repeat family protein cont... 29 2.3 At3g59140.1 68416.m06593 ABC transporter family protein putative... 29 3.1 At1g68110.1 68414.m07780 epsin N-terminal homology (ENTH) domain... 29 3.1 At5g50160.1 68418.m06212 ferric reductase-like transmembrane com... 28 5.4 At4g00930.1 68417.m00126 COP1-interacting protein 4.1 (CIP4.1) i... 28 5.4 At3g16000.1 68416.m02024 matrix-localized MAR DNA-binding protei... 28 5.4 At5g40520.1 68418.m04916 expressed protein 28 7.2 At2g41880.1 68415.m05179 guanylate kinase 1 (GK-1) identical to ... 28 7.2 At2g20590.2 68415.m02408 reticulon family protein non-consensus ... 28 7.2 At2g20590.1 68415.m02407 reticulon family protein non-consensus ... 28 7.2 At5g48460.1 68418.m05992 fimbrin-like protein, putative strong s... 27 9.5 At5g18510.1 68418.m02185 hypothetical protein 27 9.5 At5g13130.1 68418.m01504 hypothetical protein low similarity to ... 27 9.5 At3g16270.1 68416.m02053 expressed protein gene model 27 9.5 >At1g43580.1 68414.m05003 expressed protein Length = 421 Score = 34.3 bits (75), Expect = 0.082 Identities = 16/47 (34%), Positives = 29/47 (61%) Frame = +3 Query: 282 KQTQIQRAKQMVNQIDSDEEVETVVRLPPKKEVAEKLEKQAKAPRKR 422 KQT++++ + + D ++ETV RL + EV+ ++EKQ+K R Sbjct: 348 KQTKLEKIQNSLIHAAKDGDIETVRRLVEEIEVSSRVEKQSKVISNR 394 >At4g11910.1 68417.m01894 expressed protein hypothetical protein F7H19.100 -Arabidopsis thaliana,PID:e1310060 Length = 466 Score = 32.7 bits (71), Expect = 0.25 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 532 LGNNCDLK*KHSWVYLHSIVYTCRKEECWTKNWMKMN 642 L N+ +L+ WVY HS + K ECW W M+ Sbjct: 170 LNNHPELQESPVWVYFHSNIPEYNKVECWGPLWEAMS 206 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +1 Query: 532 LGNNCDLK*KHSWVYLHSIVYTCRKEECW 618 L N +L WVY HS + K ECW Sbjct: 363 LNNYPELHEAFVWVYFHSNIPKFNKVECW 391 >At5g55400.1 68418.m06902 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 714 Score = 31.5 bits (68), Expect = 0.58 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +3 Query: 264 IKIPNFKQTQIQRAKQMVNQIDSDEEVETVVRLPPKK 374 IKI +++ Q+V ++ +E++E +RLPP+K Sbjct: 237 IKIQLLADLSLKKMPQLVELVEDNEDIEEFLRLPPEK 273 >At5g45080.1 68418.m05528 disease resistance protein-related weak similarity to disease resistance protein rps4-RLD [Arabidopsis thaliana] GI:5823585; contains Pfam profile PF01582: TIR domain Length = 392 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/58 (27%), Positives = 33/58 (56%), Gaps = 5/58 (8%) Frame = +3 Query: 420 RMFMLP---KGQVEFITYLLDKYGNDYKAMEREKR--IIIQETWKQLRSKIKTFMGIP 578 R+ ++P K + + +L K+G++++A+ER R + I + WK+ I +G+P Sbjct: 99 RLIVIPIFYKVKPSAVKFLEGKFGDNFRALERNNRHMLPITQKWKEALESIPGSIGMP 156 >At4g26700.1 68417.m03848 fimbrin-like protein (FIM1) identical to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893 Length = 687 Score = 31.1 bits (67), Expect = 0.77 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +3 Query: 264 IKIPNFKQTQIQRAKQMVNQIDSDEEVETVVRLPPKK 374 IKI +++ Q+V ++ ++VE ++RLPP+K Sbjct: 236 IKIQVLADLNLKKTPQLVELLEDSDDVEELLRLPPEK 272 >At4g33600.1 68417.m04773 expressed protein Length = 453 Score = 30.7 bits (66), Expect = 1.0 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Frame = +2 Query: 236 WVL*VIQQNY-KNTKFQT--DSNSKGETNGKPDRFR*RSGNSCKTSTKEGSSREIRKT 400 W+ +I Y +NT+F D N GE NG D R ++ + C S E S I T Sbjct: 219 WLNEIITATYGQNTEFLRFRDKNRPGEKNGSLDLIRCKARHYCNISLSETSKSRIGMT 276 >At4g22920.1 68417.m03310 expressed protein Length = 268 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 532 LGNNCDLK*KHSWVYLHSIVYTCRKEECWTKNW 630 L N +L+ WVY HS V K ECW W Sbjct: 174 LNNYPELQEALVWVYFHSNVNEFNKVECWGPLW 206 >At1g33670.1 68414.m04165 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to receptor kinase-like protein GB:AAB82755 GI:2586083 from [Oryza longistaminata] (Science 270 (5243), 1804-1806 (1995)) Length = 455 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = -2 Query: 390 ISRLLPSLVEVLQLFPLLHLNRSGLPFVSPFEFESV*NLVFL 265 +S +P + +L L+L+R+G V P F ++ N++FL Sbjct: 237 LSGTIPDYLSRFELLSALNLSRNGYTGVVPMSFANLTNIIFL 278 >At3g59140.1 68416.m06593 ABC transporter family protein putative multi resistance protein mrp - Arabidopsis thaliana, EMBL:ATMRPPROT Length = 1453 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = +1 Query: 145 RKQKSTGNVQCSIVKEA---WNNKKTSARNLREMGL 243 RKQ+S GN I+K A W K ++ NLR + L Sbjct: 590 RKQRSEGNQNAIIIKSASFSWEEKGSTKPNLRNVSL 625 >At1g68110.1 68414.m07780 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related similar to clathrin assembly protein AP180 (GI:6492344) [Xenopus laevis]; contains Pfam profile: PF01417 ENTH domain, suggesting involvement in endocytosis or cytoskeletal machinery Length = 379 Score = 29.1 bits (62), Expect = 3.1 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 4/74 (5%) Frame = +3 Query: 333 DEEVETVVRLPPKKEVAEKLEK-QAKAPRKRMFML--PKGQVEFITYLLDKYGNDYKAME 503 +EEVE + ++ + KLEK + K K M +L PK IT + + +DY+ + Sbjct: 282 EEEVEAIEKMIDTVQEKPKLEKDEEKEDEKAMVVLEQPKKLQTIITDKWEIFEDDYRCFD 341 Query: 504 R-EKRIIIQETWKQ 542 R +K I ++ + Q Sbjct: 342 RKDKWEIFEDEYHQ 355 >At5g50160.1 68418.m06212 ferric reductase-like transmembrane component family protein contains Pfam profile PF01794: Ferric reductase like transmembrane component Length = 728 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 639 HLHPILCPAFLFPAGIHYTVQVYP*MFLF 553 HL+ + AFLF AG + V P MFLF Sbjct: 271 HLYIVFLVAFLFHAGDRHFYWVLPGMFLF 299 >At4g00930.1 68417.m00126 COP1-interacting protein 4.1 (CIP4.1) identical to cDNA CIP4.1 mRNA for COP1-interacting protein 4.1, GI:13160649 Length = 976 Score = 28.3 bits (60), Expect = 5.4 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +3 Query: 282 KQTQIQRAKQMVNQIDSDEEVETVVRLPPKKEVAEKLEKQAKAPRKR 422 K ++ + K +N + EE + V L KKE E LEK K KR Sbjct: 670 KSSKRSKKKDSLNIV---EEAQVVDSLQQKKEAEENLEKSGKKSSKR 713 >At3g16000.1 68416.m02024 matrix-localized MAR DNA-binding protein-related similar to matrix-localized MAR DNA binding protein MFP1 GI:1771158 from [Lycopersicon esculentum] Length = 726 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/61 (26%), Positives = 33/61 (54%) Frame = +3 Query: 333 DEEVETVVRLPPKKEVAEKLEKQAKAPRKRMFMLPKGQVEFITYLLDKYGNDYKAMEREK 512 +E++ + +L K++ +L ++ + +K L K Q+E + L K G D +A+E + Sbjct: 199 EEQLSLINQLNSAKDLVTELGRELSSEKKLCEKL-KDQIESLENSLSKAGEDKEALETKL 257 Query: 513 R 515 R Sbjct: 258 R 258 >At5g40520.1 68418.m04916 expressed protein Length = 693 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 145 RKQKSTGNVQCSIVKEAWNNKKTSARNLREMGLVSDP 255 R T N+Q IVK W +K R L+ + L DP Sbjct: 290 RFSPETKNLQNEIVKAVWLLRKVRFRELKRLHLCLDP 326 >At2g41880.1 68415.m05179 guanylate kinase 1 (GK-1) identical to guanylate kinase (GK-1) [Arabidopsis thaliana] gi|7861795|gb|AAF70408 Length = 387 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 486 DYKAMEREKRIIIQETWKQLRSKI 557 +Y + E +IIIQET K+ R+KI Sbjct: 339 EYAVSKMEDKIIIQETGKETRNKI 362 >At2g20590.2 68415.m02408 reticulon family protein non-consensus AA donor splice site at 46485 and non-consensus GG acceptor splice site at 46563, confirmed by Ceres cDNA 1885; contains Pfam profile PF02453: Reticulon Length = 323 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/42 (30%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = +3 Query: 297 QRAKQMVNQIDSDEEVETVVRLPPKKEVAE---KLEKQAKAP 413 +R + V + +++ +E +V+LPP+K K +KQ+ AP Sbjct: 104 RRRSEAVEEKEANLVIEEIVKLPPRKRKTNGRPKKDKQSSAP 145 >At2g20590.1 68415.m02407 reticulon family protein non-consensus AA donor splice site at 46485 and non-consensus GG acceptor splice site at 46563, confirmed by Ceres cDNA 1885; contains Pfam profile PF02453: Reticulon Length = 431 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/42 (30%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = +3 Query: 297 QRAKQMVNQIDSDEEVETVVRLPPKKEVAE---KLEKQAKAP 413 +R + V + +++ +E +V+LPP+K K +KQ+ AP Sbjct: 104 RRRSEAVEEKEANLVIEEIVKLPPRKRKTNGRPKKDKQSSAP 145 >At5g48460.1 68418.m05992 fimbrin-like protein, putative strong similarity to fimbrin-like protein AtFim2 [Arabidopsis thaliana] GI:2737926; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 654 Score = 27.5 bits (58), Expect = 9.5 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 264 IKIPNFKQTQIQRAKQMVNQIDSDEEVETVVRLPPKK 374 IKI +++ Q+V + ++VE ++ LPP+K Sbjct: 237 IKIQLLADLNLKKTPQLVELVGDSKDVEELMSLPPEK 273 >At5g18510.1 68418.m02185 hypothetical protein Length = 702 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +3 Query: 327 DSDEEVETVVRLPPKKEVAEKLEKQAKAPRK 419 D D +++ ++PP +V +KLE+ A R+ Sbjct: 460 DDDGDIDVSTKVPPLSQVVQKLEEGFTAKRR 490 >At5g13130.1 68418.m01504 hypothetical protein low similarity to microrchidia [Mus musculus] GI:5410255 Length = 706 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/41 (29%), Positives = 26/41 (63%) Frame = +3 Query: 288 TQIQRAKQMVNQIDSDEEVETVVRLPPKKEVAEKLEKQAKA 410 +++QR KQ++ +S +++ + + +KEV E K++KA Sbjct: 609 SELQRQKQLLELQESKAKIQNLEKAQREKEVLELQLKESKA 649 >At3g16270.1 68416.m02053 expressed protein gene model Length = 690 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 296 SKGETNGKPDRFR*RSGNSCKTSTKEGSSRE 388 S G + PD F+ GN TST GS +E Sbjct: 638 SGGNQSALPDIFQPNFGNQAPTSTMNGSKKE 668 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,305,402 Number of Sequences: 28952 Number of extensions: 252854 Number of successful extensions: 780 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 779 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -