BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00872 (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal p... 26 1.3 L07880-1|AAA29358.1| 218|Anopheles gambiae glutathione S-transf... 25 2.3 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 4.1 EF519406-1|ABP68515.1| 164|Anopheles gambiae ENSANGG00000008286... 24 4.1 EF519396-1|ABP68505.1| 176|Anopheles gambiae ENSANGG00000008286... 24 4.1 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 24 4.1 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 24 4.1 EF519405-1|ABP68514.1| 164|Anopheles gambiae ENSANGG00000008286... 23 7.2 EF519404-1|ABP68513.1| 160|Anopheles gambiae ENSANGG00000008286... 23 7.2 EF519403-1|ABP68512.1| 164|Anopheles gambiae ENSANGG00000008286... 23 7.2 EF519402-1|ABP68511.1| 176|Anopheles gambiae ENSANGG00000008286... 23 7.2 EF519399-1|ABP68508.1| 176|Anopheles gambiae ENSANGG00000008286... 23 7.2 EF519395-1|ABP68504.1| 164|Anopheles gambiae ENSANGG00000008286... 23 7.2 EF519394-1|ABP68503.1| 160|Anopheles gambiae ENSANGG00000008286... 23 7.2 EF519393-1|ABP68502.1| 160|Anopheles gambiae ENSANGG00000008286... 23 7.2 EF519392-1|ABP68501.1| 163|Anopheles gambiae ENSANGG00000008286... 23 7.2 EF519391-1|ABP68500.1| 164|Anopheles gambiae ENSANGG00000008286... 23 7.2 EF519390-1|ABP68499.1| 164|Anopheles gambiae ENSANGG00000008286... 23 7.2 EF519389-1|ABP68498.1| 164|Anopheles gambiae ENSANGG00000008286... 23 7.2 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 7.2 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 7.2 >X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal protein homologue protein. Length = 269 Score = 25.8 bits (54), Expect = 1.3 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 248 GDALCASK**SHTERGITLLQCFSRNTSPDGFIINKLCIMFS 123 G AL K S + TL++C + DGF++ CI F+ Sbjct: 105 GMALTTDKLRSMVNKWQTLIECSVDVKTTDGFMLRVFCIGFT 146 >L07880-1|AAA29358.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 25.0 bits (52), Expect = 2.3 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +3 Query: 396 DYFSDCTETIIKENYVVVYELLDEMLDN 479 DY + T+T + EN+ + E++ ++LDN Sbjct: 176 DYLNYLTKTNLLENFPNLQEVVQKVLDN 203 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.2 bits (50), Expect = 4.1 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 660 VSFIVSILYTDLLQGTFDSCPDGS 589 + F+ +++ L +G F SC DGS Sbjct: 995 LQFMFAVIGVQLYKGKFFSCSDGS 1018 >EF519406-1|ABP68515.1| 164|Anopheles gambiae ENSANGG00000008286-like protein. Length = 164 Score = 24.2 bits (50), Expect = 4.1 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ + H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFKQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >EF519396-1|ABP68505.1| 176|Anopheles gambiae ENSANGG00000008286-like protein. Length = 176 Score = 24.2 bits (50), Expect = 4.1 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFTXFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 24.2 bits (50), Expect = 4.1 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -3 Query: 525 LINSFKYYFPWPVGSHYLTFHPIIHTPPHN 436 L+N +++ P H HP +H P H+ Sbjct: 115 LLNHHQHHHQHPHLPHVQQHHPSVHHPAHH 144 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 24.2 bits (50), Expect = 4.1 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 711 GSSTFVNNCIDFFNYIKVSFIVSILYTDLLQG 616 G +TFV N DF+ +K + + LY ++ G Sbjct: 550 GKNTFVRNSRDFYWSVKDRTMYTDLYKKIMLG 581 >EF519405-1|ABP68514.1| 164|Anopheles gambiae ENSANGG00000008286-like protein. Length = 164 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFXQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >EF519404-1|ABP68513.1| 160|Anopheles gambiae ENSANGG00000008286-like protein. Length = 160 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFTQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >EF519403-1|ABP68512.1| 164|Anopheles gambiae ENSANGG00000008286-like protein. Length = 164 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFXQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >EF519402-1|ABP68511.1| 176|Anopheles gambiae ENSANGG00000008286-like protein. Length = 176 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFTQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >EF519399-1|ABP68508.1| 176|Anopheles gambiae ENSANGG00000008286-like protein. Length = 176 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFXQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >EF519395-1|ABP68504.1| 164|Anopheles gambiae ENSANGG00000008286-like protein. Length = 164 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFXQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >EF519394-1|ABP68503.1| 160|Anopheles gambiae ENSANGG00000008286-like protein. Length = 160 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFTQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >EF519393-1|ABP68502.1| 160|Anopheles gambiae ENSANGG00000008286-like protein. Length = 160 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFXQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >EF519392-1|ABP68501.1| 163|Anopheles gambiae ENSANGG00000008286-like protein. Length = 163 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFTQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >EF519391-1|ABP68500.1| 164|Anopheles gambiae ENSANGG00000008286-like protein. Length = 164 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFTQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >EF519390-1|ABP68499.1| 164|Anopheles gambiae ENSANGG00000008286-like protein. Length = 164 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFXQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >EF519389-1|ABP68498.1| 164|Anopheles gambiae ENSANGG00000008286-like protein. Length = 164 Score = 23.4 bits (48), Expect = 7.2 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 270 AAPHHYLISIHRGGVALVAVCKQE---VAPLFV-IEFLHRV------VDTFQDYFSDCTE 419 A PH+YL RG ++A+ Q+ LF+ H + +D F+ +F D E Sbjct: 18 AMPHNYLHIWPRGQFMMIALPNQDRTWTVTLFMPFTQFHSITDQGLLLDFFRQHFPDAIE 77 Query: 420 TIIKENYV 443 I +E V Sbjct: 78 LIGRERLV 85 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 501 FPWPVGSHYLTFHPIIHTPPHNF 433 FP VGS F PI+ TP + + Sbjct: 231 FPTEVGSSSGRFRPILWTPENGY 253 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 501 FPWPVGSHYLTFHPIIHTPPHNF 433 FP VGS F PI+ TP + + Sbjct: 231 FPTEVGSSSGRFRPILWTPENGY 253 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 730,002 Number of Sequences: 2352 Number of extensions: 14950 Number of successful extensions: 45 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -