BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00870 (737 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 26 0.28 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 4.5 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 26.2 bits (55), Expect = 0.28 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 111 DGVTSMLYHSRGIGEGFSGHYDEYYGLNVDT 203 D + M Y RG +G +GH+ Y VDT Sbjct: 200 DIINVMAYDLRGSWDGVTGHHSGLYPSAVDT 230 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 93 IDILLDTIAGLIVGNAKP 40 +DI LD GL GN P Sbjct: 405 VDITLDDFRGLCTGNKYP 422 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,731 Number of Sequences: 336 Number of extensions: 3058 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -