BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00870 (737 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 5.2 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 21 9.1 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 21 9.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.1 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 21 9.1 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 5.2 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +2 Query: 98 WLQVRWRDVNV 130 WL++ W DVN+ Sbjct: 75 WLKLEWNDVNM 85 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = -1 Query: 257 CIDAVHNVVGEHQVDQGLGVYIQSVIFVVVTREPFTDTA 141 C+ + G + +G GV +Q +I F DTA Sbjct: 162 CLTKIFKADGITGLYRGFGVSVQGIIIYRAAYFGFYDTA 200 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = -1 Query: 257 CIDAVHNVVGEHQVDQGLGVYIQSVIFVVVTREPFTDTA 141 C+ + G + +G GV +Q +I F DTA Sbjct: 162 CLTKIFKADGITGLYRGFGVSVQGIIIYRAAYFGFYDTA 200 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 203 RGPDLPDARQRHCAQHRYRVITIAEDV 283 +GP PD + CA ++ I+E+V Sbjct: 413 KGPANPDIFRVSCATEHSQLTNISEEV 439 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 203 RGPDLPDARQRHCAQHRYRVITIAEDV 283 +GP PD + CA ++ I+E+V Sbjct: 119 KGPANPDIFRVSCATEHSQLTNISEEV 145 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,972 Number of Sequences: 438 Number of extensions: 3902 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -