BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00869 (800 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 26 1.6 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 24 4.8 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 24 4.8 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 6.3 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 25.8 bits (54), Expect = 1.6 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +3 Query: 387 SYKAIQTTLQTDEVKNVPCGTSGGVLIYFERIEVV 491 S++AI T LQ +K VP G V YFE E+V Sbjct: 646 SWQAIATALQ---MKGVPAGLQRIVRSYFENRELV 677 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 24.2 bits (50), Expect = 4.8 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +3 Query: 282 LHKVEEGHVGVYYR 323 LH++E+G VG+Y R Sbjct: 1052 LHQLEDGEVGIYRR 1065 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 320 SGWSFITSYKSSWFSHDDTTSNIIQSHSDNFTN 418 +G + I SSW D+T +QS +DN T+ Sbjct: 722 TGMAGINGLSSSWHKVLDSTQLRLQSTTDNATD 754 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 6.3 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -2 Query: 646 DLIKQINVYLVQGMGTTELIQFMVHFIE 563 DL + + VYL +G G+ L+ ++ +E Sbjct: 3297 DLAEDVEVYLNKGQGSMNLLDERINALE 3324 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 765,798 Number of Sequences: 2352 Number of extensions: 15149 Number of successful extensions: 79 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84408009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -