BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00869 (800 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03510.1 68415.m00311 band 7 family protein contains Pfam pro... 111 7e-25 At3g02110.1 68416.m00177 serine carboxypeptidase S10 family prot... 29 4.7 At3g22670.1 68416.m02861 pentatricopeptide (PPR) repeat-containi... 28 6.3 >At2g03510.1 68415.m00311 band 7 family protein contains Pfam profile PF01145: SPFH domain / Band 7 family Length = 356 Score = 111 bits (266), Expect = 7e-25 Identities = 46/80 (57%), Positives = 62/80 (77%) Frame = +2 Query: 512 VLDMVRNFTAEYDRTLIFNKVHHELNQFCSAHTLHEVYIDLFDQIDENLRTALQKDLHEM 691 V D + N+ YD T I++K+HHE+NQFCS+H+L +VYID+FDQIDE ++ ALQ D Sbjct: 124 VYDTLLNYGVNYDNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDERMKDALQADCTRY 183 Query: 692 APGLRVQAVRVTKPKIPESI 751 APG+ + +VRVTKPKIPES+ Sbjct: 184 APGIEILSVRVTKPKIPESV 203 Score = 109 bits (263), Expect = 2e-24 Identities = 44/73 (60%), Positives = 62/73 (84%) Frame = +3 Query: 282 LHKVEEGHVGVYYRGGALLPVTSQAGFHMMIPLLTSYKAIQTTLQTDEVKNVPCGTSGGV 461 +H+V EGHVG Y+RGGALL + ++ GFH+ +P +T+Y+ +Q TLQTD+V+++PCGT GGV Sbjct: 47 VHQVPEGHVGAYWRGGALLNIITEPGFHLKLPFITNYEPVQVTLQTDQVRDIPCGTKGGV 106 Query: 462 LIYFERIEVVNKL 500 LI FE+IEVVN+L Sbjct: 107 LITFEKIEVVNRL 119 >At3g02110.1 68416.m00177 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase II (CP-MII) GB:CAA70815 (SP:P08818) [Hordeum vulgare] Length = 473 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 588 INSVVPIPCTRYTLICLIKSTRI--YGQHCKRIFMKWLQV 701 ++SVVP+ TRY+L L ST++ Y + K+ W +V Sbjct: 394 VDSVVPVTATRYSLARLSLSTKLPWYPWYVKKQVGGWTEV 433 >At3g22670.1 68416.m02861 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 562 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +2 Query: 515 LDMVRNFTAEYDRTLIFNKVHHELNQFCSAHTLHEVYIDLFDQIDENLRT 664 L+M +++ + D T+ N + L + S HEV++ LFD I + RT Sbjct: 227 LEMEKSYGVKTD-TIAMNSLMDALVKENSIEHAHEVFLKLFDTIKPDART 275 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,760,351 Number of Sequences: 28952 Number of extensions: 320379 Number of successful extensions: 707 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 707 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1814318400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -