BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00867 (761 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 4.1 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 9.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.4 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 476 HLPSGCRRRWISPRRYHP 423 H P+G + WI+ RY P Sbjct: 794 HTPNGIVKTWIAHDRYLP 811 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = +1 Query: 505 LFQEFKRKYKKDLATNKRALRRLRTACERAKRTLSSSTQASIE 633 +F + D N+RA +LRT E + T+ + I+ Sbjct: 377 IFSPHEENESVDKHPNRRARGQLRTKIESGEGTIPVKSSEGIQ 419 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 494 MVNHFSRSSRGNTKRTSL 547 M +H+ R++ GN +R L Sbjct: 241 MFSHYDRNNNGNLEREEL 258 Score = 21.4 bits (43), Expect = 9.4 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +2 Query: 230 VLQ*LSKTTTKDAGTI-SGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDV 406 V+Q +S K A + + LN+ I P+ Y + + N+L DL G ++ Sbjct: 768 VVQEISSDGLKFAFDVKTTLNISDIALYPSQTTHGYDIYASSIDKENILFLDLSTGKVEM 827 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,875 Number of Sequences: 438 Number of extensions: 4796 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -