BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00865 (756 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g33680.1 68414.m04166 KH domain-containing protein similar to... 28 7.7 >At1g33680.1 68414.m04166 KH domain-containing protein similar to FUSE binding protein 2 GB:AAC50892 GI:1575607 from [Homo sapiens] Length = 759 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 223 PGVGPCGAAAVHEAGADPDLGASYEVRPHLDRSVPHQ 113 PG P A+ +AGA G Y+ +PH D HQ Sbjct: 486 PGPVPSHGASYSQAGAQQTYGQMYD-QPHYDNPPMHQ 521 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.316 0.131 0.418 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,729,144 Number of Sequences: 28952 Number of extensions: 154788 Number of successful extensions: 465 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -