BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00863 (533 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 24 0.73 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 24 0.73 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 24 0.73 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 24 0.73 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 24 0.73 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 5.2 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 9.0 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.73 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = -2 Query: 439 CKPRCGP*CYLAHDVCVNRLVLDEPPALNNTDFASSNIKW 320 C R G C+ HD L + PP + DF S W Sbjct: 427 CGLRNGDPCFF-HDTIPPYLFFESPPVVFLNDFISHQHAW 465 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.73 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = -2 Query: 439 CKPRCGP*CYLAHDVCVNRLVLDEPPALNNTDFASSNIKW 320 C R G C+ HD L + PP + DF S W Sbjct: 427 CGLRNGDPCFF-HDTIPPYLFFESPPVVFLNDFISHQHAW 465 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.73 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = -2 Query: 439 CKPRCGP*CYLAHDVCVNRLVLDEPPALNNTDFASSNIKW 320 C R G C+ HD L + PP + DF S W Sbjct: 427 CGLRNGDPCFF-HDTIPPYLFFESPPVVFLNDFISHQHAW 465 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.73 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = -2 Query: 439 CKPRCGP*CYLAHDVCVNRLVLDEPPALNNTDFASSNIKW 320 C R G C+ HD L + PP + DF S W Sbjct: 427 CGLRNGDPCFF-HDTIPPYLFFESPPVVFLNDFISHQHAW 465 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 24.2 bits (50), Expect = 0.73 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +2 Query: 305 LGGIRPFYVRTCEVCVVQSWWFVQYQSIH 391 L G+ +Y TC++ + +W S+H Sbjct: 306 LFGVLAYYSTTCDIATILDFWVRCVLSLH 334 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.4 bits (43), Expect = 5.2 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -1 Query: 356 EQHRLRKFEHKMGGCLRGLIWH 291 E+HRL F +G L WH Sbjct: 190 EEHRLAYFREDLGINLHHWHWH 211 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 20.6 bits (41), Expect = 9.0 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -3 Query: 441 YVNPDVVHDVIWRMTSA*IDWYWTN 367 YV+ V +W +A + WTN Sbjct: 527 YVDDSSVESRVWPRAAAAAERLWTN 551 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,018 Number of Sequences: 336 Number of extensions: 1725 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -