BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00863 (533 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G10.02c |tea3||cell end marker Tea3|Schizosaccharomyces pom... 25 5.4 SPAC644.12 |cdc5||cell division control protein Cdc5|Schizosacch... 25 9.4 >SPAC6G10.02c |tea3||cell end marker Tea3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1125 Score = 25.4 bits (53), Expect = 5.4 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -3 Query: 354 TTQTSQVRT*NGRMP-PRVDLARTDIDVXLYILNHRSGDGYVRRHVW 217 T ++VR+ GR P PR T ID +YI R G + +W Sbjct: 282 TLSWTEVRS-IGRFPGPREGHQATTIDDTVYIYGGRDNKGLILNELW 327 >SPAC644.12 |cdc5||cell division control protein Cdc5|Schizosaccharomyces pombe|chr 1|||Manual Length = 757 Score = 24.6 bits (51), Expect = 9.4 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 210 RTATHVVSRSHHQIDDSRYKGKRQYPFVPNQPSEASA 320 RTAT + R +DD K Q + + +EA+A Sbjct: 89 RTATQCLERYQKLLDDLEAKENEQLGLISGEGAEAAA 125 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,696,544 Number of Sequences: 5004 Number of extensions: 27939 Number of successful extensions: 76 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -