BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00862 (726 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 54 1e-07 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 53 3e-07 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 53 3e-07 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 53 3e-07 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 52 4e-07 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 52 5e-07 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 52 5e-07 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 52 5e-07 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 52 5e-07 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 52 5e-07 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 52 5e-07 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 52 5e-07 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 52 5e-07 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 52 6e-07 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 52 6e-07 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 52 6e-07 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 52 6e-07 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 52 6e-07 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 52 6e-07 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 52 6e-07 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 52 6e-07 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 52 6e-07 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 52 6e-07 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 51 8e-07 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 51 8e-07 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 51 8e-07 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 51 8e-07 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 51 8e-07 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 51 8e-07 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 51 1e-06 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 51 1e-06 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 51 1e-06 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 51 1e-06 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 51 1e-06 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 51 1e-06 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 51 1e-06 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 51 1e-06 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 51 1e-06 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 51 1e-06 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 51 1e-06 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 51 1e-06 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 51 1e-06 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 51 1e-06 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 51 1e-06 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 51 1e-06 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 51 1e-06 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 51 1e-06 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 51 1e-06 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 51 1e-06 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 51 1e-06 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 51 1e-06 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 51 1e-06 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 51 1e-06 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 51 1e-06 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 51 1e-06 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 51 1e-06 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 51 1e-06 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 51 1e-06 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 51 1e-06 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 51 1e-06 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 55.2 bits (127), Expect = 5e-08 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 LLV NSCSPGDPLVLERPPPRWSS Sbjct: 16 LLVSNSCSPGDPLVLERPPPRWSS 39 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 54.4 bits (125), Expect = 9e-08 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +LV NSCSPGDPLVLERPPPRWSS Sbjct: 8 ILVSNSCSPGDPLVLERPPPRWSS 31 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 54.4 bits (125), Expect = 9e-08 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +LV NSCSPGDPLVLERPPPRWSS Sbjct: 4 MLVSNSCSPGDPLVLERPPPRWSS 27 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 54.4 bits (125), Expect = 9e-08 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +LV NSCSPGDPLVLERPPPRWSS Sbjct: 1 MLVSNSCSPGDPLVLERPPPRWSS 24 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 54.4 bits (125), Expect = 9e-08 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +LV NSCSPGDPLVLERPPPRWSS Sbjct: 25 MLVSNSCSPGDPLVLERPPPRWSS 48 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 54.0 bits (124), Expect = 1e-07 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -1 Query: 132 IKYWYERCAXXXXXXXXXXRLLVPNSCSPGDPLVLERPPPRWSS 1 + Y E CA + NSCSPGDPLVLERPPPRWSS Sbjct: 25 LDYVIEVCAAAGLTKSTTESTITSNSCSPGDPLVLERPPPRWSS 68 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 54.0 bits (124), Expect = 1e-07 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L++ NSCSPGDPLVLERPPPRWSS Sbjct: 25 LIISNSCSPGDPLVLERPPPRWSS 48 >SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) Length = 551 Score = 54.0 bits (124), Expect = 1e-07 Identities = 28/58 (48%), Positives = 34/58 (58%) Frame = -1 Query: 174 STCRVRRVTTVSCKIKYWYERCAXXXXXXXXXXRLLVPNSCSPGDPLVLERPPPRWSS 1 STC V+ ++ + WYE R++ NSCSPGDPLVLERPPPRWSS Sbjct: 393 STCWYCMVSVLTGIV--WYEFLLVSYGINAYWYRMVSSNSCSPGDPLVLERPPPRWSS 448 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 LV NSCSPGDPLVLERPPPRWSS Sbjct: 24 LVSNSCSPGDPLVLERPPPRWSS 46 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L V NSCSPGDPLVLERPPPRWSS Sbjct: 8 LFVSNSCSPGDPLVLERPPPRWSS 31 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 LV NSCSPGDPLVLERPPPRWSS Sbjct: 3 LVSNSCSPGDPLVLERPPPRWSS 25 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 LL NSCSPGDPLVLERPPPRWSS Sbjct: 77 LLTSNSCSPGDPLVLERPPPRWSS 100 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 LL NSCSPGDPLVLERPPPRWSS Sbjct: 4 LLASNSCSPGDPLVLERPPPRWSS 27 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 LV NSCSPGDPLVLERPPPRWSS Sbjct: 26 LVSNSCSPGDPLVLERPPPRWSS 48 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 LL NSCSPGDPLVLERPPPRWSS Sbjct: 87 LLTSNSCSPGDPLVLERPPPRWSS 110 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 33 LISNSCSPGDPLVLERPPPRWSS 55 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 17 LISNSCSPGDPLVLERPPPRWSS 39 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 37 LISNSCSPGDPLVLERPPPRWSS 59 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 8 LISNSCSPGDPLVLERPPPRWSS 30 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 33 LISNSCSPGDPLVLERPPPRWSS 55 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 53.2 bits (122), Expect = 2e-07 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +++ NSCSPGDPLVLERPPPRWSS Sbjct: 13 IIISNSCSPGDPLVLERPPPRWSS 36 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 33 LISNSCSPGDPLVLERPPPRWSS 55 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L V NSCSPGDPLVLERPPPRWSS Sbjct: 2 LYVSNSCSPGDPLVLERPPPRWSS 25 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 33 LISNSCSPGDPLVLERPPPRWSS 55 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 24 LISNSCSPGDPLVLERPPPRWSS 46 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +L+ NSCSPGDPLVLERPPPRWSS Sbjct: 5 ILLSNSCSPGDPLVLERPPPRWSS 28 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 33 LISNSCSPGDPLVLERPPPRWSS 55 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 33 LISNSCSPGDPLVLERPPPRWSS 55 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 40 LISNSCSPGDPLVLERPPPRWSS 62 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 33 LISNSCSPGDPLVLERPPPRWSS 55 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 70 LISNSCSPGDPLVLERPPPRWSS 92 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 34 LISNSCSPGDPLVLERPPPRWSS 56 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 21 LISNSCSPGDPLVLERPPPRWSS 43 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 16 LISNSCSPGDPLVLERPPPRWSS 38 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 33 LISNSCSPGDPLVLERPPPRWSS 55 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 31 LISNSCSPGDPLVLERPPPRWSS 53 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 +V NSCSPGDPLVLERPPPRWSS Sbjct: 347 IVSNSCSPGDPLVLERPPPRWSS 369 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 LL NSCSPGDPLVLERPPPRWSS Sbjct: 24 LLPSNSCSPGDPLVLERPPPRWSS 47 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 19 LITSNSCSPGDPLVLERPPPRWSS 42 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L V NSCSPGDPLVLERPPPRWSS Sbjct: 38 LRVSNSCSPGDPLVLERPPPRWSS 61 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 52.8 bits (121), Expect = 3e-07 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +++ NSCSPGDPLVLERPPPRWSS Sbjct: 13 IVISNSCSPGDPLVLERPPPRWSS 36 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 +V NSCSPGDPLVLERPPPRWSS Sbjct: 77 IVSNSCSPGDPLVLERPPPRWSS 99 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 52.8 bits (121), Expect = 3e-07 Identities = 31/71 (43%), Positives = 37/71 (52%) Frame = -1 Query: 213 EVLNISEGLTHYSSTCRVRRVTTVSCKIKYWYERCAXXXXXXXXXXRLLVPNSCSPGDPL 34 + LNI E + S C VT +I +Y+ C + NSCSPGDPL Sbjct: 115 DALNIQEHVQEVS--CYYNGVTLSKGQI--FYKGCHRCECRMEGINCEVGSNSCSPGDPL 170 Query: 33 VLERPPPRWSS 1 VLERPPPRWSS Sbjct: 171 VLERPPPRWSS 181 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 ++V NSCSPGDPLVLERPPPRWSS Sbjct: 6 VVVSNSCSPGDPLVLERPPPRWSS 29 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 +V NSCSPGDPLVLERPPPRWSS Sbjct: 11 MVSNSCSPGDPLVLERPPPRWSS 33 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 +V NSCSPGDPLVLERPPPRWSS Sbjct: 1 MVSNSCSPGDPLVLERPPPRWSS 23 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 52.8 bits (121), Expect = 3e-07 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +++ NSCSPGDPLVLERPPPRWSS Sbjct: 4 VIISNSCSPGDPLVLERPPPRWSS 27 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L V NSCSPGDPLVLERPPPRWSS Sbjct: 16 LKVSNSCSPGDPLVLERPPPRWSS 39 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 +V NSCSPGDPLVLERPPPRWSS Sbjct: 85 IVSNSCSPGDPLVLERPPPRWSS 107 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +L NSCSPGDPLVLERPPPRWSS Sbjct: 10 MLASNSCSPGDPLVLERPPPRWSS 33 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 +V NSCSPGDPLVLERPPPRWSS Sbjct: 13 IVSNSCSPGDPLVLERPPPRWSS 35 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 +V NSCSPGDPLVLERPPPRWSS Sbjct: 6 IVSNSCSPGDPLVLERPPPRWSS 28 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 +V NSCSPGDPLVLERPPPRWSS Sbjct: 1 MVSNSCSPGDPLVLERPPPRWSS 23 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 LL NSCSPGDPLVLERPPPRWSS Sbjct: 21 LLPSNSCSPGDPLVLERPPPRWSS 44 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L V NSCSPGDPLVLERPPPRWSS Sbjct: 7 LRVSNSCSPGDPLVLERPPPRWSS 30 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 52.8 bits (121), Expect = 3e-07 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +++ NSCSPGDPLVLERPPPRWSS Sbjct: 24 IVISNSCSPGDPLVLERPPPRWSS 47 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 144 LITSNSCSPGDPLVLERPPPRWSS 167 >SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 5 LITSNSCSPGDPLVLERPPPRWSS 28 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L + NSCSPGDPLVLERPPPRWSS Sbjct: 99 LKISNSCSPGDPLVLERPPPRWSS 122 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 17 IISNSCSPGDPLVLERPPPRWSS 39 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 890 LVTSNSCSPGDPLVLERPPPRWSS 913 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 62 LLSNSCSPGDPLVLERPPPRWSS 84 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 119 IISNSCSPGDPLVLERPPPRWSS 141 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L + NSCSPGDPLVLERPPPRWSS Sbjct: 6 LFLSNSCSPGDPLVLERPPPRWSS 29 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 +V NSCSPGDPLVLERPPPRWSS Sbjct: 3474 VVSNSCSPGDPLVLERPPPRWSS 3496 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 52.4 bits (120), Expect = 4e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L V NSCSPGDPLVLERPPPRWSS Sbjct: 3 LHVSNSCSPGDPLVLERPPPRWSS 26 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 52.4 bits (120), Expect = 4e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L V NSCSPGDPLVLERPPPRWSS Sbjct: 5 LHVSNSCSPGDPLVLERPPPRWSS 28 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 13 IISNSCSPGDPLVLERPPPRWSS 35 >SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L + NSCSPGDPLVLERPPPRWSS Sbjct: 4 LFLSNSCSPGDPLVLERPPPRWSS 27 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 54 LLSNSCSPGDPLVLERPPPRWSS 76 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 2 LLSNSCSPGDPLVLERPPPRWSS 24 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +L NSCSPGDPLVLERPPPRWSS Sbjct: 16 VLASNSCSPGDPLVLERPPPRWSS 39 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 +V NSCSPGDPLVLERPPPRWSS Sbjct: 19 VVSNSCSPGDPLVLERPPPRWSS 41 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +L NSCSPGDPLVLERPPPRWSS Sbjct: 36 VLTSNSCSPGDPLVLERPPPRWSS 59 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 + V NSCSPGDPLVLERPPPRWSS Sbjct: 30 IAVSNSCSPGDPLVLERPPPRWSS 53 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L + NSCSPGDPLVLERPPPRWSS Sbjct: 169 LFLSNSCSPGDPLVLERPPPRWSS 192 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 1 MISNSCSPGDPLVLERPPPRWSS 23 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 19 LVASNSCSPGDPLVLERPPPRWSS 42 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.4 bits (120), Expect = 4e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L V NSCSPGDPLVLERPPPRWSS Sbjct: 12 LEVSNSCSPGDPLVLERPPPRWSS 35 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 1 LLSNSCSPGDPLVLERPPPRWSS 23 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 4 IISNSCSPGDPLVLERPPPRWSS 26 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 52.4 bits (120), Expect = 4e-07 Identities = 23/24 (95%), Positives = 23/24 (95%), Gaps = 1/24 (4%) Frame = -1 Query: 69 LVP-NSCSPGDPLVLERPPPRWSS 1 LVP NSCSPGDPLVLERPPPRWSS Sbjct: 27 LVPSNSCSPGDPLVLERPPPRWSS 50 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 7 LLSNSCSPGDPLVLERPPPRWSS 29 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 +V NSCSPGDPLVLERPPPRWSS Sbjct: 27 VVSNSCSPGDPLVLERPPPRWSS 49 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 13 IISNSCSPGDPLVLERPPPRWSS 35 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 52.4 bits (120), Expect = 4e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +L NSCSPGDPLVLERPPPRWSS Sbjct: 3 VLASNSCSPGDPLVLERPPPRWSS 26 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 30 VSNSCSPGDPLVLERPPPRWSS 51 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 7 VSNSCSPGDPLVLERPPPRWSS 28 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 15 VSNSCSPGDPLVLERPPPRWSS 36 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 2 VSNSCSPGDPLVLERPPPRWSS 23 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 15 LTSNSCSPGDPLVLERPPPRWSS 37 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.0 bits (119), Expect = 5e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 + + NSCSPGDPLVLERPPPRWSS Sbjct: 7 ITISNSCSPGDPLVLERPPPRWSS 30 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 117 VSNSCSPGDPLVLERPPPRWSS 138 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 184 VSNSCSPGDPLVLERPPPRWSS 205 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 34 VSNSCSPGDPLVLERPPPRWSS 55 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 1066 VSNSCSPGDPLVLERPPPRWSS 1087 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 3 VSNSCSPGDPLVLERPPPRWSS 24 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 214 VSNSCSPGDPLVLERPPPRWSS 235 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 32 VSNSCSPGDPLVLERPPPRWSS 53 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 3 VSNSCSPGDPLVLERPPPRWSS 24 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 64 VSNSCSPGDPLVLERPPPRWSS 85 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 52.0 bits (119), Expect = 5e-07 Identities = 27/64 (42%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Frame = -1 Query: 189 LTHYSSTCRVRRVTTVS-CKIKYWYERCAXXXXXXXXXXRLLVPNSCSPGDPLVLERPPP 13 + H++ T +T S C + Y ++ C NSCSPGDPLVLERPPP Sbjct: 1 MKHFTDTLISANITFNSACSLVYTFKICTSRQLSITS-----TSNSCSPGDPLVLERPPP 55 Query: 12 RWSS 1 RWSS Sbjct: 56 RWSS 59 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 4 VSNSCSPGDPLVLERPPPRWSS 25 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 6 LASNSCSPGDPLVLERPPPRWSS 28 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 19 VSNSCSPGDPLVLERPPPRWSS 40 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +L NSCSPGDPLVLERPPPRWSS Sbjct: 64 ILPSNSCSPGDPLVLERPPPRWSS 87 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 11 VSNSCSPGDPLVLERPPPRWSS 32 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 25 VSNSCSPGDPLVLERPPPRWSS 46 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 15 VSNSCSPGDPLVLERPPPRWSS 36 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 10 VSNSCSPGDPLVLERPPPRWSS 31 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 59 VSNSCSPGDPLVLERPPPRWSS 80 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 31 VSNSCSPGDPLVLERPPPRWSS 52 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 4 VSNSCSPGDPLVLERPPPRWSS 25 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 41 VSNSCSPGDPLVLERPPPRWSS 62 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 15 VSNSCSPGDPLVLERPPPRWSS 36 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 4 VSNSCSPGDPLVLERPPPRWSS 25 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 14 VSNSCSPGDPLVLERPPPRWSS 35 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 6 VSNSCSPGDPLVLERPPPRWSS 27 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 52.0 bits (119), Expect = 5e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 5 VISNSCSPGDPLVLERPPPRWSS 27 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 52.0 bits (119), Expect = 5e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 24 IITSNSCSPGDPLVLERPPPRWSS 47 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 15 VSNSCSPGDPLVLERPPPRWSS 36 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 20 LASNSCSPGDPLVLERPPPRWSS 42 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 11 LTSNSCSPGDPLVLERPPPRWSS 33 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 30 VSNSCSPGDPLVLERPPPRWSS 51 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 10 VSNSCSPGDPLVLERPPPRWSS 31 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 17 VSNSCSPGDPLVLERPPPRWSS 38 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 34 VSNSCSPGDPLVLERPPPRWSS 55 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.0 bits (119), Expect = 5e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 17 VISNSCSPGDPLVLERPPPRWSS 39 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 52.0 bits (119), Expect = 5e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 + + NSCSPGDPLVLERPPPRWSS Sbjct: 88 MTISNSCSPGDPLVLERPPPRWSS 111 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 8 VSNSCSPGDPLVLERPPPRWSS 29 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 10 VSNSCSPGDPLVLERPPPRWSS 31 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 23 VSNSCSPGDPLVLERPPPRWSS 44 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 18 VSNSCSPGDPLVLERPPPRWSS 39 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 11 LASNSCSPGDPLVLERPPPRWSS 33 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 3 LASNSCSPGDPLVLERPPPRWSS 25 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 15 LTSNSCSPGDPLVLERPPPRWSS 37 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 661 LASNSCSPGDPLVLERPPPRWSS 683 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 27 VSNSCSPGDPLVLERPPPRWSS 48 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 7 LASNSCSPGDPLVLERPPPRWSS 29 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 193 VSNSCSPGDPLVLERPPPRWSS 214 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 17 VSNSCSPGDPLVLERPPPRWSS 38 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 11 LTSNSCSPGDPLVLERPPPRWSS 33 >SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L + NSCSPGDPLVLERPPPRWSS Sbjct: 16 LALSNSCSPGDPLVLERPPPRWSS 39 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 96 LASNSCSPGDPLVLERPPPRWSS 118 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L + NSCSPGDPLVLERPPPRWSS Sbjct: 10 LEISNSCSPGDPLVLERPPPRWSS 33 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 V NSCSPGDPLVLERPPPRWSS Sbjct: 10 VSNSCSPGDPLVLERPPPRWSS 31 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 5 ISNSCSPGDPLVLERPPPRWSS 26 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +L NSCSPGDPLVLERPPPRWSS Sbjct: 1 MLRSNSCSPGDPLVLERPPPRWSS 24 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 28 LTASNSCSPGDPLVLERPPPRWSS 51 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 261 ISNSCSPGDPLVLERPPPRWSS 282 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 16 ISNSCSPGDPLVLERPPPRWSS 37 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 13 ILSNSCSPGDPLVLERPPPRWSS 35 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 21 ISNSCSPGDPLVLERPPPRWSS 42 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 + + NSCSPGDPLVLERPPPRWSS Sbjct: 13 IFLSNSCSPGDPLVLERPPPRWSS 36 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 59 ISNSCSPGDPLVLERPPPRWSS 80 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 10 IVTSNSCSPGDPLVLERPPPRWSS 33 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 + + NSCSPGDPLVLERPPPRWSS Sbjct: 48 IFLSNSCSPGDPLVLERPPPRWSS 71 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 10 ISNSCSPGDPLVLERPPPRWSS 31 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 3 ISNSCSPGDPLVLERPPPRWSS 24 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 51.6 bits (118), Expect = 6e-07 Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 2/26 (7%) Frame = -1 Query: 72 LLVP--NSCSPGDPLVLERPPPRWSS 1 LL P NSCSPGDPLVLERPPPRWSS Sbjct: 17 LLAPTSNSCSPGDPLVLERPPPRWSS 42 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 55 ILSNSCSPGDPLVLERPPPRWSS 77 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 13 ISNSCSPGDPLVLERPPPRWSS 34 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 88 IVTSNSCSPGDPLVLERPPPRWSS 111 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 4 ISNSCSPGDPLVLERPPPRWSS 25 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 52 ISNSCSPGDPLVLERPPPRWSS 73 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 51 ISNSCSPGDPLVLERPPPRWSS 72 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 16 ISNSCSPGDPLVLERPPPRWSS 37 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 2 VITSNSCSPGDPLVLERPPPRWSS 25 >SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L + NSCSPGDPLVLERPPPRWSS Sbjct: 2 LSLSNSCSPGDPLVLERPPPRWSS 25 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 21 ISNSCSPGDPLVLERPPPRWSS 42 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 152 ISNSCSPGDPLVLERPPPRWSS 173 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 4 ISNSCSPGDPLVLERPPPRWSS 25 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 + + NSCSPGDPLVLERPPPRWSS Sbjct: 33 IFLSNSCSPGDPLVLERPPPRWSS 56 >SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 4 LTASNSCSPGDPLVLERPPPRWSS 27 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 47 ISNSCSPGDPLVLERPPPRWSS 68 >SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 147 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 21 LTTSNSCSPGDPLVLERPPPRWSS 44 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 7 ISNSCSPGDPLVLERPPPRWSS 28 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 4 ISNSCSPGDPLVLERPPPRWSS 25 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 +L NSCSPGDPLVLERPPPRWSS Sbjct: 17 ILGSNSCSPGDPLVLERPPPRWSS 40 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 32 ISNSCSPGDPLVLERPPPRWSS 53 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 18 ISNSCSPGDPLVLERPPPRWSS 39 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 32 ISNSCSPGDPLVLERPPPRWSS 53 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 974 ISNSCSPGDPLVLERPPPRWSS 995 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 6 ISNSCSPGDPLVLERPPPRWSS 27 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 17 LTASNSCSPGDPLVLERPPPRWSS 40 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 65 MLSNSCSPGDPLVLERPPPRWSS 87 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 1 ISNSCSPGDPLVLERPPPRWSS 22 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 5 ISNSCSPGDPLVLERPPPRWSS 26 >SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 9 VITSNSCSPGDPLVLERPPPRWSS 32 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 32 ISNSCSPGDPLVLERPPPRWSS 53 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 116 ISNSCSPGDPLVLERPPPRWSS 137 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 2 ISNSCSPGDPLVLERPPPRWSS 23 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 2 ISNSCSPGDPLVLERPPPRWSS 23 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 14 ISNSCSPGDPLVLERPPPRWSS 35 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 2 ISNSCSPGDPLVLERPPPRWSS 23 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 8 ISNSCSPGDPLVLERPPPRWSS 29 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 52 ISNSCSPGDPLVLERPPPRWSS 73 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L+ NSCSPGDPLVLERPPPRWSS Sbjct: 53 LMRSNSCSPGDPLVLERPPPRWSS 76 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 104 ILSNSCSPGDPLVLERPPPRWSS 126 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 7 ISNSCSPGDPLVLERPPPRWSS 28 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 12 ILSNSCSPGDPLVLERPPPRWSS 34 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 6 ISNSCSPGDPLVLERPPPRWSS 27 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 68 ISNSCSPGDPLVLERPPPRWSS 89 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 11 IVASNSCSPGDPLVLERPPPRWSS 34 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 30 ISNSCSPGDPLVLERPPPRWSS 51 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 46 ISNSCSPGDPLVLERPPPRWSS 67 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 45 ISNSCSPGDPLVLERPPPRWSS 66 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 591 ISNSCSPGDPLVLERPPPRWSS 612 >SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 4 ISNSCSPGDPLVLERPPPRWSS 25 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 10 ISNSCSPGDPLVLERPPPRWSS 31 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 51.6 bits (118), Expect = 6e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 66 VPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 10 ISNSCSPGDPLVLERPPPRWSS 31 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 13 IASNSCSPGDPLVLERPPPRWSS 35 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 1 MASNSCSPGDPLVLERPPPRWSS 23 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 45 VVTSNSCSPGDPLVLERPPPRWSS 68 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 92 VLSNSCSPGDPLVLERPPPRWSS 114 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 4 LSASNSCSPGDPLVLERPPPRWSS 27 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 37 IASNSCSPGDPLVLERPPPRWSS 59 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 23 LSSNSCSPGDPLVLERPPPRWSS 45 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L + NSCSPGDPLVLERPPPRWSS Sbjct: 21 LELSNSCSPGDPLVLERPPPRWSS 44 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 12 VLSNSCSPGDPLVLERPPPRWSS 34 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 15 VLSNSCSPGDPLVLERPPPRWSS 37 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 82 MASNSCSPGDPLVLERPPPRWSS 104 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 10 LSTSNSCSPGDPLVLERPPPRWSS 33 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 7 LPSNSCSPGDPLVLERPPPRWSS 29 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 + + NSCSPGDPLVLERPPPRWSS Sbjct: 9 VFLSNSCSPGDPLVLERPPPRWSS 32 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 4 LSSNSCSPGDPLVLERPPPRWSS 26 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 18 ITSNSCSPGDPLVLERPPPRWSS 40 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 6 IFTSNSCSPGDPLVLERPPPRWSS 29 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 34 LSSNSCSPGDPLVLERPPPRWSS 56 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 33 VLSNSCSPGDPLVLERPPPRWSS 55 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 3 LSSNSCSPGDPLVLERPPPRWSS 25 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 27 LPSNSCSPGDPLVLERPPPRWSS 49 >SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 2 VLSNSCSPGDPLVLERPPPRWSS 24 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 6 LPSNSCSPGDPLVLERPPPRWSS 28 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 28 IASNSCSPGDPLVLERPPPRWSS 50 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 25 ITSNSCSPGDPLVLERPPPRWSS 47 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 23 VLSNSCSPGDPLVLERPPPRWSS 45 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 13 ITSNSCSPGDPLVLERPPPRWSS 35 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 66 LSSNSCSPGDPLVLERPPPRWSS 88 >SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 1 MASNSCSPGDPLVLERPPPRWSS 23 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 2421 IASNSCSPGDPLVLERPPPRWSS 2443 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 19 VLSNSCSPGDPLVLERPPPRWSS 41 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 L NSCSPGDPLVLERPPPRWSS Sbjct: 85 LSSNSCSPGDPLVLERPPPRWSS 107 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 4 IASNSCSPGDPLVLERPPPRWSS 26 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 46 IASNSCSPGDPLVLERPPPRWSS 68 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 13 VLSNSCSPGDPLVLERPPPRWSS 35 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 16 ITSNSCSPGDPLVLERPPPRWSS 38 >SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 1 MIKSNSCSPGDPLVLERPPPRWSS 24 >SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -1 Query: 72 LLVPNSCSPGDPLVLERPPPRWSS 1 ++ NSCSPGDPLVLERPPPRWSS Sbjct: 13 IISSNSCSPGDPLVLERPPPRWSS 36 >SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -1 Query: 69 LVPNSCSPGDPLVLERPPPRWSS 1 + NSCSPGDPLVLERPPPRWSS Sbjct: 3 ITSNSCSPGDPLVLERPPPRWSS 25 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,947,177 Number of Sequences: 59808 Number of extensions: 384658 Number of successful extensions: 2661 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2654 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -