BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00861 (797 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 25 2.0 AY645023-1|AAT92559.1| 99|Anopheles gambiae wingless protein. 25 2.0 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 3.6 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 25 3.6 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 23 8.3 AY146730-1|AAO12090.1| 131|Anopheles gambiae odorant-binding pr... 23 8.3 AJ618929-1|CAF02008.1| 144|Anopheles gambiae odorant-binding pr... 23 8.3 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 23 8.3 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 25.4 bits (53), Expect = 2.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 247 IASRCKWRVGPRQYSGIRCSP 185 IA C+ +GP+ Y G++ SP Sbjct: 46 IADECERFLGPKGYGGVQLSP 66 >AY645023-1|AAT92559.1| 99|Anopheles gambiae wingless protein. Length = 99 Score = 25.4 bits (53), Expect = 2.0 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Frame = +3 Query: 249 PPEKEETHAHDQDPGF-RCNP--GEQFT--RDCNDCTCSADGKSVFC 374 PP ++ + PGF NP G Q T R CND + DG + C Sbjct: 12 PPGSKDLVYLEPSPGFCERNPRLGIQGTHGRQCNDTSIGVDGCDLMC 58 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 3.6 Identities = 18/77 (23%), Positives = 28/77 (36%) Frame = +2 Query: 59 PALVWIATLSTVTTMLSPSTATELKEK*VRSQPRAFPAPSTIRAATYAAVLTRADTPLAP 238 P L + + + P + TE + +Q P T+ A A+ P A Sbjct: 1437 PTLAALQNEAKSSYQQQPDSGTEQAPREATAQLPPVQPPETLTPAGSVAITVEPSVPPAT 1496 Query: 239 *CDAPREGGDACARPGS 289 D E G + A PG+ Sbjct: 1497 TTDLEPESGVSEAPPGT 1513 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 53 TSPALVWIATLSTVTTMLSPSTAT 124 T+ VWI +T TT + P+T T Sbjct: 216 TTTTTVWIDPTATTTTHVPPTTTT 239 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 23.4 bits (48), Expect = 8.3 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 Query: 44 KAKTSPALVWIATLSTVTTMLSPSTAT 124 +A S A +TLSTVTT L P T Sbjct: 808 RATESTATESSSTLSTVTTTLPPVVTT 834 >AY146730-1|AAO12090.1| 131|Anopheles gambiae odorant-binding protein AgamOBP22 protein. Length = 131 Score = 23.4 bits (48), Expect = 8.3 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +1 Query: 31 LCDKEGKDFSCTRMDCNALNSNHNA 105 LC++ F C R D +N+NA Sbjct: 104 LCERAYSAFQCLREDYEMYQNNNNA 128 >AJ618929-1|CAF02008.1| 144|Anopheles gambiae odorant-binding protein OBPjj83b protein. Length = 144 Score = 23.4 bits (48), Expect = 8.3 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +1 Query: 31 LCDKEGKDFSCTRMDCNALNSNHNA 105 LC++ F C R D +N+NA Sbjct: 117 LCERAYSAFQCLREDYEMYQNNNNA 141 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.4 bits (48), Expect = 8.3 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = +1 Query: 157 TCVPGSVYNQGCNVCRCTDE 216 TC PG++++ ++C D+ Sbjct: 500 TCPPGTLFDPALHICNWADQ 519 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 809,330 Number of Sequences: 2352 Number of extensions: 17300 Number of successful extensions: 82 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -