BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00853 (692 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000EB2908 Cluster: UPI0000EB2908 related cluster; n... 33 8.8 UniRef50_Q5TUJ1 Cluster: ENSANGP00000026074; n=4; Endopterygota|... 33 8.8 >UniRef50_UPI0000EB2908 Cluster: UPI0000EB2908 related cluster; n=1; Canis lupus familiaris|Rep: UPI0000EB2908 UniRef100 entry - Canis familiaris Length = 3509 Score = 32.7 bits (71), Expect = 8.8 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +3 Query: 12 SRGVPASGA*GSSQETRQRGGQREKETQETVFGAGRHQNRTRRLGH 149 +RG P S S TR+R G R +++ + AG HQ + GH Sbjct: 1283 TRGHPDSAHRDSGSSTRERQGSRHEQSGDRARHAGSHQGQQATRGH 1328 Score = 32.7 bits (71), Expect = 8.8 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +3 Query: 12 SRGVPASGA*GSSQETRQRGGQREKETQETVFGAGRHQNRTRRLGH 149 +RG P S S TR+R G R +++ + AG HQ + GH Sbjct: 1325 TRGHPDSAHRDSESSTRERQGSRHEQSGDRARHAGSHQGQQATRGH 1370 Score = 32.7 bits (71), Expect = 8.8 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +3 Query: 12 SRGVPASGA*GSSQETRQRGGQREKETQETVFGAGRHQNRTRRLGH 149 +RG P S S TR+R G R +++ + AG HQ + GH Sbjct: 1811 TRGHPDSAHRDSGSSTRERQGSRHEQSGDRARHAGSHQGQQATRGH 1856 >UniRef50_Q5TUJ1 Cluster: ENSANGP00000026074; n=4; Endopterygota|Rep: ENSANGP00000026074 - Anopheles gambiae str. PEST Length = 521 Score = 32.7 bits (71), Expect = 8.8 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 5/64 (7%) Frame = -2 Query: 589 RYNLQSVGTFPDGLTMPTV-DYSIIQS----RFNIMMMNGLFIMVFCNILGVFKNYTFNF 425 +Y+++++GT P GL PT+ D+S++ S F + M+ + I +NY F Sbjct: 270 KYSIKTIGTIPTGLPAPTLPDFSLMPSILIDSFPVAMVGYTVSVSMALIFAKKENYEIGF 329 Query: 424 DESL 413 ++ L Sbjct: 330 NQEL 333 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 671,934,717 Number of Sequences: 1657284 Number of extensions: 13178835 Number of successful extensions: 31883 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31873 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54545459628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -